+ Now that it's unzipped, go into the VisualC
+ directory that is created, and double-click on the VC++ file "SDL.dsw"
+ ("SDL.sln").
+
+ You may be prompted at this point to upgrade the workspace, should you be using
+ a more recent version of Visual C++. If so, allow the workspace to be upgraded.
+
+
+ This is done by right clicking on each project in turn (Projects are listed in
+ the Workspace panel in the FileView tab), and selecting "Build".
+
+
+ If you get an error about SDL_config.h being missing, you should
+ copy include/SDL_config.h.default to include/SDL_config.h and try again.
+
+
+ You may get a few warnings, but you should not get any errors. You do have to
+ have at least the DirectX 5 SDK installed, however. The latest
+ version of DirectX can be downloaded or purchased on a cheap CD (my
+ recommendation) from Microsoft .
+
+
+ Later, we will refer to the following .lib and .dll files that have just been
+ generated:
+
+
+ Search for these using the Windows Find (Windows-F) utility, if you don't
+ already know where they should be. For those of you with a clue, look inside
+ the Debug or Release directories of the subdirectories of the Project folder.
+ (It might be easier to just use Windows Find if this sounds confusing. And
+ don't worry about needing a clue; we all need visits from the clue fairy
+ frequently.)
+
+
+ Now we're going to use the files that we had created earlier in the Build SDL
+ step.
+
+
+ Add the following files to your project (It is not necessary to copy them to
+ your project directory):
+
+
+ (To add them to your project, right click on your project, and select "Add
+ files to project")
+
+
+ Now create the basic body of your project. The body of your program should take
+ the following form:
+
+#include "SDL.h"
+
+int main( int argc, char* argv[] )
+{
+ // Body of the program goes here.
+ return 0;
+}
+
+
+
+ I hope that this document has helped you get through the most difficult part of
+ using the SDL: installing it. Suggestions for improvements to this document
+ should be sent to the writers of this document.
+
+
+ Thanks to Paulus Esterhazy (pesterhazy@gmx.net), for the work on VC++ port.
+
+
+ Later, it was converted to HTML and expanded into the document that you see
+ today by Lion Kimbro .
+
+ , the UK keyboard
+ should now work properly, as well as the "Windows" keys on US
+ keyboards.
+
+ The Linux CD-ROM code now reads the CD-ROM devices from /etc/fstab
+ instead of trying to open each block device on the system.
+ The CD must be listed in /etc/fstab as using the iso9660 filesystem.
+
+ On Linux, if you define THREADED_EVENTS at compile time, a separate
+ thread will be spawned to gather X events asynchronously from the
+ graphics updates. This hasn't been extensively tested, but it does
+ provide a means of handling keyboard and mouse input in a separate
+ thread from the graphics thread. (This is now enabled by default.)
+
+ A special access function SDL_PeepEvents() allows you to manipulate
+ the event queue in a thread-safe manner, including peeking at events,
+ removing events of a specified type, and adding new events of arbitrary
+ type to the queue (use the new 'user' member of the SDL_Event type).
+
+ If you use SDL_PeepEvents() to gather events, then the main graphics
+ thread needs to call SDL_PumpEvents() periodically to drive the event
+ loop and generate input events. This is not necessary if SDL has been
+ compiled with THREADED_EVENTS defined, but doesn't hurt.
+
+ A new function SDL_ThreadID() returns the identifier associated with
+ the current thread.
+
+0.9.9:
+ The AUDIO_STEREO format flag has been replaced with a new 'channels'
+ member of the SDL_AudioSpec structure. The channels are 1 for mono
+ audio, and 2 for stereo audio. In the future more channels may be
+ supported for 3D surround sound.
+
+ The SDL_MixAudio() function now takes an additional volume parameter,
+ which should be set to SDL_MIX_MAXVOLUME for compatibility with the
+ original function.
+
+ The CD-ROM functions which take a 'cdrom' parameter can now be
+ passed NULL, and will act on the last successfully opened CD-ROM.
+
+0.9.8:
+ No changes, bugfixes only.
+
+0.9.7:
+ No changes, bugfixes only.
+
+0.9.6:
+ Added a fast rectangle fill function: SDL_FillRect()
+
+ Addition of a useful function for getting info on the video hardware:
+ const SDL_VideoInfo *SDL_GetVideoInfo(void)
+ This function replaces SDL_GetDisplayFormat().
+
+ Initial support for double-buffering:
+ Use the SDL_DOUBLEBUF flag in SDL_SetVideoMode()
+ Update the screen with a new function: SDL_Flip()
+
+ SDL_AllocSurface() takes two new flags:
+ SDL_SRCCOLORKEY means that the surface will be used for colorkey blits
+ and if the hardware supports hardware acceleration of colorkey blits
+ between two surfaces in video memory, to place the surface in video
+ memory if possible, otherwise it will be placed in system memory.
+ SDL_SRCALPHA means that the surface will be used for alpha blits and
+ if the hardware supports hardware acceleration of alpha blits between
+ two surfaces in video memory, to place the surface in video memory
+ if possible, otherwise it will be placed in system memory.
+ SDL_HWSURFACE now means that the surface will be created with the
+ same format as the display surface, since having surfaces in video
+ memory is only useful for fast blitting to the screen, and you can't
+ blit surfaces with different surface formats in video memory.
+
+0.9.5:
+ You can now pass a NULL mask to SDL_WM_SetIcon(), and it will assume
+ that the icon consists of the entire image.
+
+ SDL_LowerBlit() is back -- but don't use it on the display surface.
+ It is exactly the same as SDL_MiddleBlit(), but doesn't check for
+ thread safety.
+
+ Added SDL_FPLoadBMP(), SDL_FPSaveBMP(), SDL_FPLoadWAV(), which take
+ a FILE pointer instead of a file name.
+
+ Added CD-ROM audio control API:
+ SDL_CDNumDrives()
+ SDL_CDName()
+ SDL_CDOpen()
+ SDL_CDStatus()
+ SDL_CDPlayTracks()
+ SDL_CDPlay()
+ SDL_CDPause()
+ SDL_CDResume()
+ SDL_CDStop()
+ SDL_CDEject()
+ SDL_CDClose()
+
+0.9.4:
+ No changes, bugfixes only.
+
+0.9.3:
+ Mouse motion event now includes relative motion information:
+ Sint16 event->motion.xrel, Sint16 event->motion.yrel
+
+ X11 keyrepeat handling can be disabled by defining IGNORE_X_KEYREPEAT
+ (Add -DIGNORE_X_KEYREPEAT to CFLAGS line in obj/x11Makefile)
+
+0.9.2:
+ No changes, bugfixes only.
+
+0.9.1:
+ Removed SDL_MapSurface() and SDL_UnmapSurface() -- surfaces are now
+ automatically mapped on blit.
+
+0.8.0:
+ SDL stable release
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/docs.html b/dep/recastnavigation/RecastDemo/Contrib/SDL/docs.html
new file mode 100644
index 000000000..66ca9235a
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/docs.html
@@ -0,0 +1,629 @@
+
+SDL Stable Release
+
+
+
+This source is stable, and is fully tested on all supported platforms.http://www.libsdl.org/mailing-list.php SDL website .
+
+
+
+
+ SDL 1.2.14 Release Notes
+
+SDL 1.2.14 is a significant bug fix release and a recommended update.
+
+
+ General Notes
+
+
+
+ Fixed flicker when resizing the SDL window
+
+
+ Fixed crash in SDL_SetGammaRamp()
+
+
+ Fixed freeze in SDL_memset() with 0 length when assembly code is disabled.
+
+
+ Added SDL_DISABLE_LOCK_KEYS environment variable to enable normal up/down events for Caps-Lock and Num-Lock keys.
+
+
+ Fixed audio quality problem when converting between 22050 Hz and 44100 Hz.
+
+
+ Fixed a threading crash when a few threads are rapidly created and complete.
+
+
+ Increased accuracy of alpha blending routines.
+
+
+ Fixed crash loading BMP files saved with the scanlines inverted.
+
+
+ Fixed mouse coordinate clamping if SDL_SetVideoMode() isn't called in response to SDL_VIDEORESIZE event.
+
+
+ Added doxygen documentation for the SDL API headers.
+
+
+
+ Unix Notes
+
+
+
+ Fixed potential memory corruption due to assembly bug with SDL_revcpy()
+
+
+ Fixed crashes trying to detect SSE features on x86_64 architecture.
+
+
+ Fixed assembly for GCC optimized 50% alpha blending blits.
+
+
+ Added configure option --enable-screensaver, to allow enabling the screensaver by default.
+
+
+ Use XResetScreenSaver() instead of disabling screensaver entirely.
+
+
+ Removed the maximum window size limitation on X11.
+
+
+ Fixed SDL_GL_SWAP_CONTROL on X11.
+
+
+ Fixed setting the X11 window input hint.
+
+
+ Fixed distorted X11 window icon for some visuals.
+
+
+ Fixed detecting X11 libraries for dynamic loading on 64-bit Linux.
+
+
+ SDL_GL_GetAttribute(SDL_GL_SWAP_CONTROL) returns the correct value with GLX_SGI_swap_control.
+
+
+ Added SDL_VIDEO_FULLSCREEN_DISPLAY as a preferred synonym for SDL_VIDEO_FULLSCREEN_HEAD on X11.
+
+
+ The SDL_VIDEO_FULLSCREEN_DISPLAY environment variable can be set to 0 to place fullscreen SDL windows on the first Xinerama screen.
+
+
+ Added the SDL_VIDEO_FBCON_ROTATION environment variable to control output orientation on the framebuffer console.
+
+ not set - Not rotating, no shadow.
+ "NONE" - Not rotating, but still using shadow.
+ "CW" - Rotating screen clockwise.
+ "UD" - Rotating screen upside down.
+ "CCW" - Rotating screen counter clockwise.
+
+
+
+ Fixed DirectFB detection on some Linux distributions.
+
+
+ Added code to use the PS3 SPE processors for YUV conversion on Linux.
+
+
+ Updated ALSA support to the latest stable API
+
+
+ ALSA is now preferred over OSS audio. (SDL_AUDIODRIVER=dsp will restore the previous behavior.)
+
+
+ Improved support for PulseAudio
+
+
+ The Network Audio System support is now dynamically loaded at runtime.
+
+
+ Fixed crash with the MP-8866 Dual USB Joypad on newer Linux kernels.
+
+
+ Fixed crash in SDL_Quit() when a joystick has been unplugged.
+
+
+
+ Windows Notes
+
+
+
+ Verified 100% compatibility with Windows 7.
+
+
+ Prevent loss of OpenGL context when setting the video mode in response to a window resize event.
+
+
+ Fixed video initialization with SDL_WINDOWID on Windows XP.
+
+
+ Improved mouse input responsiveness for first-person-shooter games.
+
+
+ IME messages are now generated for localized input.
+
+
+ SDL_RWFromFile() takes a UTF-8 filename when opening a file.
+
+
+ The SDL_STDIO_REDIRECT environment variable can be used to override whether SDL redirects stdio to stdout.txt and stderr.txt.
+
+
+ Fixed dynamic object loading on Windows CE.
+
+
+
+ Mac OS X Notes
+
+
+
+ SDL now builds on Mac OS X 10.6 (Snow Leopard).
+ http://playcontrol.net/ewing/jibberjabber/big_behind-the-scenes_chang.html
+
+
+ The X11 video driver is built by default.
+
+
+ Fixed SDL_VIDEO_WINDOW_POS environment variable for Quartz target.
+
+
+ Fixed setting the starting working directory in release builds.
+
+
+
+ SDL 1.2.13 Release Notes
+
+SDL 1.2.13 is a minor bug fix release.
+
+
+ General Notes
+
+
+
+ Fixed link error when building with Intel Compiler 10.
+
+
+ Removed stray C++ comment from public headers.
+
+
+
+ Unix Notes
+
+
+
+ Fixed crash in SDL_SoftStretch() on secure operating systems.
+
+
+ Fixed undefined symbol on X11 implementations without UTF-8 support.
+
+
+ Worked around BadAlloc error when using XVideo on the XFree86 Intel Integrated Graphics driver.
+
+
+ Scan for all joysticks on Linux instead of stopping at one that was removed.
+
+
+ Fixed use of sdl-config arguments in sdl.m4
+
+
+
+ Windows Notes
+
+
+
+ Fixed crash when a video driver reports higher than 32 bpp video modes.
+
+
+ Fixed restoring the desktop after setting a 24-bit OpenGL video mode.
+
+
+ Fixed window titles on Windows 95/98/ME.
+
+
+ Added SDL_BUTTON_X1 and SDL_BUTTON_X2 constants for extended mouse buttons.
+
+
+ Added support for quoted command line arguments.
+
+
+
+ Mac OS X Notes
+
+
+
+ SDL now builds on Mac OS X 10.5 (Leopard).
+
+
+ Fixed high frequency crash involving text input.
+
+
+ Fixed beeping when the escape key is pressed and UNICODE translation is enabled.
+
+
+ Improved trackpad scrolling support.
+
+
+ Fixed joystick hat reporting for certain joysticks.
+
+
+
+ SDL 1.2.12 Release Notes
+
+SDL 1.2.12 is a minor bug fix release.
+
+
+ General Notes
+
+
+
+ Added support for the PulseAudio sound server: http://www.pulseaudio.org/
+
+
+ Added SDL_VIDEO_ALLOW_SCREENSAVER to override SDL's disabling of the screensaver on Mac OS X, Windows, and X11.
+
+
+ Fixed buffer overrun crash when resampling audio rates.
+
+
+ Fixed audio bug where converting to mono was doubling the volume.
+
+
+ Fixed off-by-one error in the C implementation of SDL_revcpy()
+
+
+ Fixed compiling with Sun Studio.
+
+
+ Support for AmigaOS has been removed from the main SDL code.
+
+
+ Support for Nokia 9210 "EPOC" driver has been removed from the main SDL code.
+
+
+ Unofficial support for the S60/SymbianOS platform has been added.
+
+
+ Unofficial support for the Nintendo DS platform has been added.
+
+
+ Reenabled MMX assembly for YUV overlay processing (GNU C Compiler only).
+
+
+
+ Unix Notes
+
+
+
+ Fixed detection of X11 DGA mouse support.
+
+
+ Improved XIM support for asian character sets.
+
+
+ The GFX_Display has been added to the X11 window information in SDL_syswm.h.
+
+
+ Fixed PAGE_SIZE compile error in the fbcon video driver on newer Linux kernels.
+
+
+ Fixed hang or crash at startup if aRts can't access the hardware.
+
+
+ Fixed relative mouse mode when the cursor starts outside the X11 window.
+
+
+ Fixed accidental free of stack memory in X11 mouse acceleration code.
+
+
+ Closed minor memory leak in XME code.
+
+
+ Fixed TEXTRELs in the library to resolve some PIC issues.
+
+
+
+ Windows Notes
+
+
+
+ The GDI video driver makes better use of the palette in 8-bit modes.
+
+
+ The windib driver now supports more mouse buttons with WM_XBUTTON events.
+
+
+ On Windows, SDL_SetVideoMode() will re-create the window instead of failing if the multisample settings are changed.
+
+
+ Added support for UTF-8 window titles on Windows.
+
+
+ Fixed joystick detection on Windows.
+
+
+ Improved performance with Win32 file I/O.
+
+
+ Fixed HBITMAP leak in GAPI driver.
+
+
+
+ Mac OS X Notes
+
+
+
+ Added support for multi-axis controllers like 3Dconnxion's SpaceNavigator on Mac OS X.
+
+
+ Fixed YUV overlay crash inside Quicktime on Intel Mac OS X.
+
+
+ Fixed blitting alignment in Altivec alpha blit functions.
+
+
+ Keys F13, F14, and F15 are now usable on Apple keyboards under Mac OS X.
+
+
+ Fixed joystick calibration code on Mac OS X.
+
+
+ Fixed mouse jitter when multiple motion events are queued up in Mac OS X.
+
+
+ Fixed changing the cursor in fullscreen mode on Mac OS X.
+
+
+
+ Mac OS Classic Notes
+
+
+
+ Added support for gamma ramps to both toolbox and DrawSprocket video drivers.
+
+
+
+ BeOS Notes
+
+
+
+ Implemented mouse grabbing and mouse relative mode on BeOS.
+
+
+
+ SDL 1.2.11 Release Notes
+
+SDL 1.2.11 is a minor bug fix release.
+
+
+ Unix Notes
+
+
+
+ Dynamic X11 loading is only enabled with gcc 4 supporting -fvisibility=hidden. This fixes crashes related to symbol collisions, and allows building on Solaris and IRIX.
+
+
+ Fixed building SDL with Xinerama disabled.
+
+
+ Fixed DRI OpenGL library loading, using RTLD_GLOBAL in dlopen().
+
+
+ Added pkgconfig configuration support.
+
+
+
+ Windows Notes
+
+
+
+ Setting SDL_GL_SWAP_CONTROL now works with Windows OpenGL.
+
+
+ The Win32 window positioning code works properly for windows with menus.
+
+
+ DirectSound audio quality has been improved on certain sound cards.
+
+
+ Fixed 5.1 audio channel ordering on Windows and Mac OS X.
+
+
+ Plugged a couple of minor memory leaks in the windib video driver.
+
+
+ Fixed type collision with stdint.h when building with gcc on Win32.
+
+
+ Fixed building with the Digital Mars Compiler on Win32.
+
+
+
+ Mac OS X Notes
+
+
+
+ The Quartz video driver supports 32x32 cursors on Mac OS X 10.3 and above.
+
+
+
+ SDL 1.2.10 Release Notes
+
+SDL 1.2.10 is a major release, featuring a revamp of the build system and many API improvements and bug fixes.
+
+ API enhancements
+
+
+ General Notes
+
+
+
+ The SDL website now has an RSS feed !
+
+ The SDL development source code is now managed with Subversion .
+
+ SDL now uses the Bugzilla bug tracking system , hosted by icculus.org.
+
+ SDL is licensed under version 2.1 of the GNU Lesser General Public License.
+
+ The entire build system has been revamped to make it much more portable, including versions of C library functions to make it possible to run SDL on a minimal embedded environment. See README.Porting in the SDL source distribution for information on how to port SDL to a new platform.
+
+ SDL_opengl.h has been updated with the latest glext.h from http://oss.sgi.com/projects/ogl-sample/registry/
+
+ Alex Volkov contributed highly optimized RGB <-> RGBA blitters.
+
+
+ Unix Notes
+
+
+
+ The X11 libraries are dynamically loaded at runtime by default. This allows the distributed version of SDL to run on systems without X11 libraries installed.
+
+ The XiG XME extension code is now included in the X11 video driver by default.
+
+ XRandR support for video mode switching has been added to the X11 driver, but is disabled because of undesired interactions with window managers. You can enable this by setting the environment variable SDL_VIDEO_X11_XRANDR to 1.
+
+ Xinerama multi-head displays are properly handled now, and the SDL_VIDEO_FULLSCREEN_HEAD environment variable can be used to select the screen used for fullscreen video modes. Note that changing the video modes only works on screen 0.
+
+ XVidMode video modes are now sorted so they maintain the refresh rates specified in the X11 configuration file.
+
+ SDL windows are no longer transparent in X11 compositing systems like XGL.
+
+ The mouse is properly released by the X11 video driver if the fullscreen window loses focus.
+
+ The X11 input driver now uses XIM to handle international input.
+
+ The screensaver and DPMS monitor blanking are disabled while SDL games are running under the X11 and DGA video drivers. This behavior will be formalized and selectable in SDL 1.3.
+
+ Fixed a bug preventing stereo OpenGL contexts from being selected on the X11 driver.
+
+ The DGA video driver now waits for pending blits involving surfaces before they are freed. This prevents display oddities when using SDL_DisplayFormat() to convert many images.
+
+ The framebuffer console video driver now has a parser for /etc/fb.modes for improved video mode handling.
+
+ The framebuffer console video driver now allows asynchronous VT switching, and restores the full contents of the screen when switched back.
+
+ The framebuffer console now uses CTRL-ALT-FN to switch virtual terminals, to avoid collisions with application key bindings.
+
+ The framebuffer console input driver correctly sets IMPS/2 mode for wheel mice. It also properly detects when gpm is in IMPS/2 protocol mode, or passing raw protocol from an IMPS/2 mouse.
+
+ The SVGAlib video driver now has support for banked (non-linear) video modes.
+
+ A video driver for OpenBSD on the Sharp Zaurus has been contributed by Staffan Ulfberg. See the file README.wscons in the SDL source distribution for details.
+
+ Many patches have been incorporated from *BSD ports.
+
+
+ Windows Notes
+
+
+
+ The "windib" video driver is the default now, to prevent problems with certain laptops, 64-bit Windows, and Windows Vista. The DirectX driver is still available, and can be selected by setting the environment variable SDL_VIDEODRIVER to "directx".
+
+ SDL has been ported to 64-bit Windows.
+
+ Dmitry Yakimov contributed a GAPI video driver for Windows CE.
+
+ The default fullscreen refresh rate has been increased to match the desktop refresh rate, when using equivalent resolutions. A full API for querying and selecting refresh rates is planned for SDL 1.3.
+
+ Dialog boxes are now shown when SDL is in windowed OpenGL mode.
+
+ The SDL window is recreated when necessary to maintain OpenGL context attributes, when switching between windowed and fullscreen modes.
+
+ An SDL_VIDEORESIZE event is properly sent when the SDL window is maximized and restored.
+
+ Window positions are retained when switching between fullscreen and windowed modes.
+
+ ToUnicode() is used, when available, for improved handling of international keyboard input.
+
+ The PrtScrn is now treated normally with both key down and key up events.
+
+ Pressing ALT-F4 now delivers an SDL_QUIT event to SDL applications.
+
+ Joystick names are now correct for joysticks which have been unplugged and then plugged back in since booting.
+
+ An MCI error when playing the last track on a CD-ROM has been fixed.
+
+ OpenWatcom projects for building SDL have been provided by Marc Peter.
+
+
+ Mac OS X Notes
+
+
+
+ SDL now supports building Universal binaries, both through Xcode projects and when using configure/make. See README.MacOSX in the SDL source archive for details.
+
+ The X11 video driver with GLX support can be built on Mac OS X, if the X11 development SDK is installed.
+
+ Transitions between fullscreen resolutions and windowed mode now use a much faster asynchronous fade to hide desktop flicker.
+
+ Icons set with SDL_WM_SetIcon() now have the proper colors on Intel Macs.
+
+
+ OS/2 Notes
+
+
+
+ Projects for building SDL on OS/2 with OpenWatcom have been contributed by Doodle. See the file README.OS2 in the SDL source distribution for details.
+
+
+Audio Sound on the computer is translated from waves that you hear into a series of
+values, or samples, each representing the amplitude of the wave. When these
+samples are sent in a stream to a sound card, an approximation of the original
+wave can be recreated. The more bits used to represent the amplitude, and the
+greater frequency these samples are gathered, the closer the approximated
+sound is to the original, and the better the quality of sound.
This library supports both 8 and 16 bit signed and unsigned sound samples,
+at frequencies ranging from 11025 Hz to 44100 Hz, depending on the
+underlying hardware. If the hardware doesn't support the desired audio
+format or frequency, it can be emulated if desired (See
+SDL_OpenAudio()
A commonly supported audio format is 16 bits per sample at 22050 Hz.
CD-ROM SDL supports audio control of up to 32 local CD-ROM drives at once.
You use this API to perform all the basic functions of a CD player,
+including listing the tracks, playing, stopping, and ejecting the CD-ROM.
+(Currently, multi-changer CD drives are not supported.)
Before you call any of the SDL CD-ROM functions, you must first call
+"SDL_Init(SDL_INIT_CDROM) ", which scans the system for
+CD-ROM drives, and sets the program up for audio control. Check the
+return code, which should be 0 , to see if there
+were any errors in starting up.
After you have initialized the library, you can find out how many drives
+are available using the SDL_CDNumDrives() function.
+The first drive listed is the system default CD-ROM drive. After you have
+chosen a drive, and have opened it with SDL_CDOpen() ,
+you can check the status and start playing if there's a CD in the drive.
A CD-ROM is organized into one or more tracks, each consisting of a certain
+number of "frames". Each frame is ~2K in size, and at normal playing speed,
+a CD plays 75 frames per second. SDL works with the number of frames on a
+CD, but this can easily be converted to the more familiar minutes/seconds
+format by using the FRAMES_TO_MSF() macro.
Events Event handling allows your application to receive input from the user. Event handling is initalised (along with video) with a call to:
+
SDL_Init(SDL_INIT_VIDEO);
+Internally, SDL stores all the events waiting to be handled in an event queue. Using functions like
SDL_PollEvent and
SDL_PeepEvents you can observe and handle waiting input events.
The key to event handling in SDL is the SDL_Event SDL_Event unions, one for each waiting event. SDL_Event unions are read from the queue with the SDL_PollEvent function and it is then up to the application to process the information stored with them.
Event Functions. SDL Library Documentation Prev Chapter 8. Events Next
SDL Event Structures. SDL Library Documentation Prev Chapter 8. Events Next
General Before SDL can be used in a program it must be initialized with SDL_Init SDL_Init initializes all the subsystems that the user requests (video, audio, joystick, timers and/or cdrom). Once SDL is initialized with SDL_Init subsystems can be shut down and initialized as needed using SDL_InitSubSystem SDL_QuitSubSystem
SDL must also be shut down before the program exits to make sure it cleans up correctly. Calling SDL_Quit
SDL Guide About SDLdoc SDL Library Documentation Prev Preface Next
SDLdoc (The SDL Documentation Project) was formed to completely rewrite the SDL documentation and to keep it continually up to date. The team consists completely of volunteers ranging from people working with SDL in their spare time to people who use SDL in their everyday working lives.
The latest version of this documentation can always be found here: http://sdldoc.csn.ul.ie Downloadable PS, man pages and html tarballs are available at http://sdldoc.csn.ul.ie/pub/
Audio Examples SDL Library Documentation Prev Chapter 4. Examples Next
SDL_AudioSpec wanted;
+ extern void fill_audio(void *udata, Uint8 *stream, int len);
+
+ /* Set the audio format */
+ wanted.freq = 22050;
+ wanted.format = AUDIO_S16;
+ wanted.channels = 2; /* 1 = mono, 2 = stereo */
+ wanted.samples = 1024; /* Good low-latency value for callback */
+ wanted.callback = fill_audio;
+ wanted.userdata = NULL;
+
+ /* Open the audio device, forcing the desired format */
+ if ( SDL_OpenAudio(&wanted, NULL) < 0 ) {
+ fprintf(stderr, "Couldn't open audio: %s\n", SDL_GetError());
+ return(-1);
+ }
+ return(0);
static Uint8 *audio_chunk;
+ static Uint32 audio_len;
+ static Uint8 *audio_pos;
+
+ /* The audio function callback takes the following parameters:
+ stream: A pointer to the audio buffer to be filled
+ len: The length (in bytes) of the audio buffer
+ */
+ void fill_audio(void *udata, Uint8 *stream, int len)
+ {
+ /* Only play if we have data left */
+ if ( audio_len == 0 )
+ return;
+
+ /* Mix as much data as possible */
+ len = ( len > audio_len ? audio_len : len );
+ SDL_MixAudio(stream, audio_pos, len, SDL_MIX_MAXVOLUME);
+ audio_pos += len;
+ audio_len -= len;
+ }
+
+ /* Load the audio data ... */
+
+ ;;;;;
+
+ audio_pos = audio_chunk;
+
+ /* Let the callback function play the audio chunk */
+ SDL_PauseAudio(0);
+
+ /* Do some processing */
+
+ ;;;;;
+
+ /* Wait for sound to complete */
+ while ( audio_len > 0 ) {
+ SDL_Delay(100); /* Sleep 1/10 second */
+ }
+ SDL_CloseAudio(); Initializing SDL SDL Library Documentation Prev Chapter 1. The Basics Next
SDL is composed of eight subsystems - Audio, CDROM, Event Handling, File I/O, Joystick Handling, Threading, Timers and Video. Before you can use any of these subsystems they must be initialized by calling SDL_Init SDL_InitSubSystem SDL_Init must be called before any other SDL function. It automatically initializes the Event Handling, File I/O and Threading subsystems and it takes a parameter specifying which other subsystems to initialize. So, to initialize the default subsystems and the Video subsystems you would call:
+
SDL_Init ( SDL_INIT_VIDEO );
+To initialize the default subsystems, the Video subsystem and the Timers subsystem you would call:
+
SDL_Init ( SDL_INIT_VIDEO | SDL_INIT_TIMER ); SDL_Init is complemented by SDL_Quit SDL_QuitSubSystem SDL_Quit shuts down all subsystems, including the default ones. It should always be called before a SDL application exits.
With SDL_Init and SDL_Quit firmly embedded in your programmers toolkit you can write your first and most basic SDL application. However, we must be prepare to handle errors. Many SDL functions return a value and indicates whether the function has succeeded or failed, SDL_Init , for instance, returns -1 if it could not initialize a subsystem. SDL provides a useful facility that allows you to determine exactly what the problem was, every time an error occurs within SDL an error message is stored which can be retrieved using SDL_GetError . Use this often, you can never know too much about an error.
Example 1-1. Initializing SDL
#include "SDL.h" /* All SDL App's need this */
+#include <stdio.h>
+
+int main(int argc, char *argv[]) {
+
+ printf("Initializing SDL.\n");
+
+ /* Initialize defaults, Video and Audio */
+ if((SDL_Init(SDL_INIT_VIDEO|SDL_INIT_AUDIO)==-1)) {
+ printf("Could not initialize SDL: %s.\n", SDL_GetError());
+ exit(-1);
+ }
+
+ printf("SDL initialized.\n");
+
+ printf("Quiting SDL.\n");
+
+ /* Shutdown all subsystems */
+ SDL_Quit();
+
+ printf("Quiting....\n");
+
+ exit(0);
+}
CDROM Examples SDL Library Documentation Prev Chapter 4. Examples Next
#include "SDL.h"
+
+ /* Initialize SDL first */
+ if ( SDL_Init(SDL_INIT_CDROM) < 0 ) {
+ fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError());
+ exit(1);
+ }
+ atexit(SDL_Quit);
+
+ /* Find out how many CD-ROM drives are connected to the system */
+ printf("Drives available: %d\n", SDL_CDNumDrives());
+ for ( i=0; i<SDL_CDNumDrives(); ++i ) {
+ printf("Drive %d: \"%s\"\n", i, SDL_CDName(i));
+ }
SDL_CD *cdrom;
+ CDstatus status;
+ char *status_str;
+
+ cdrom = SDL_CDOpen(0);
+ if ( cdrom == NULL ) {
+ fprintf(stderr, "Couldn't open default CD-ROM drive: %s\n",
+ SDL_GetError());
+ exit(2);
+ }
+
+ status = SDL_CDStatus(cdrom);
+ switch (status) {
+ case CD_TRAYEMPTY:
+ status_str = "tray empty";
+ break;
+ case CD_STOPPED:
+ status_str = "stopped";
+ break;
+ case CD_PLAYING:
+ status_str = "playing";
+ break;
+ case CD_PAUSED:
+ status_str = "paused";
+ break;
+ case CD_ERROR:
+ status_str = "error state";
+ break;
+ }
+ printf("Drive status: %s\n", status_str);
+ if ( status >= CD_PLAYING ) {
+ int m, s, f;
+ FRAMES_TO_MSF(cdrom->cur_frame, &m, &s, &f);
+ printf("Currently playing track %d, %d:%2.2d\n",
+ cdrom->track[cdrom->cur_track].id, m, s);
+ }
SDL_CD *cdrom; /* Assuming this has already been set.. */
+ int i;
+ int m, s, f;
+
+ SDL_CDStatus(cdrom);
+ printf("Drive tracks: %d\n", cdrom->numtracks);
+ for ( i=0; i<cdrom->numtracks; ++i ) {
+ FRAMES_TO_MSF(cdrom->track[i].length, &m, &s, &f);
+ if ( f > 0 )
+ ++s;
+ printf("\tTrack (index %d) %d: %d:%2.2d\n", i,
+ cdrom->track[i].id, m, s);
+ }
SDL_CD *cdrom; /* Assuming this has already been set.. */
+
+ // Play entire CD:
+ if ( CD_INDRIVE(SDL_CDStatus(cdrom)) )
+ SDL_CDPlayTracks(cdrom, 0, 0, 0, 0);
+
+ // Play last track:
+ if ( CD_INDRIVE(SDL_CDStatus(cdrom)) ) {
+ SDL_CDPlayTracks(cdrom, cdrom->numtracks-1, 0, 0, 0);
+ }
+
+ // Play first and second track and 10 seconds of third track:
+ if ( CD_INDRIVE(SDL_CDStatus(cdrom)) )
+ SDL_CDPlayTracks(cdrom, 0, 0, 2, CD_FPS * 10); Credits SDL Library Documentation Prev Preface Next
Sam Lantinga, slouken@libsdl.org Martin Donlon, akawaka@skynet.ie Mattias Engdegård Julian Peterson Ken Jordan Maxim Sobolev Wesley Poole Michael Vance Andreas Umbach Andreas Hofmeister
Event Examples SDL Library Documentation Prev Chapter 4. Examples Next
#include <stdio.h>
+#include <stdlib.h>
+
+#include "SDL.h"
+
+/* This function may run in a separate event thread */
+int FilterEvents(const SDL_Event *event) {
+ static int boycott = 1;
+
+ /* This quit event signals the closing of the window */
+ if ( (event->type == SDL_QUIT) && boycott ) {
+ printf("Quit event filtered out -- try again.\n");
+ boycott = 0;
+ return(0);
+ }
+ if ( event->type == SDL_MOUSEMOTION ) {
+ printf("Mouse moved to (%d,%d)\n",
+ event->motion.x, event->motion.y);
+ return(0); /* Drop it, we've handled it */
+ }
+ return(1);
+}
+
+int main(int argc, char *argv[])
+{
+ SDL_Event event;
+
+ /* Initialize the SDL library (starts the event loop) */
+ if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) {
+ fprintf(stderr,
+ "Couldn't initialize SDL: %s\n", SDL_GetError());
+ exit(1);
+ }
+
+ /* Clean up on exit, exit on window close and interrupt */
+ atexit(SDL_Quit);
+
+ /* Ignore key events */
+ SDL_EventState(SDL_KEYDOWN, SDL_IGNORE);
+ SDL_EventState(SDL_KEYUP, SDL_IGNORE);
+
+ /* Filter quit and mouse motion events */
+ SDL_SetEventFilter(FilterEvents);
+
+ /* The mouse isn't much use unless we have a display for reference */
+ if ( SDL_SetVideoMode(640, 480, 8, 0) == NULL ) {
+ fprintf(stderr, "Couldn't set 640x480x8 video mode: %s\n",
+ SDL_GetError());
+ exit(1);
+ }
+
+ /* Loop waiting for ESC+Mouse_Button */
+ while ( SDL_WaitEvent(&event) >= 0 ) {
+ switch (event.type) {
+ case SDL_ACTIVEEVENT: {
+ if ( event.active.state & SDL_APPACTIVE ) {
+ if ( event.active.gain ) {
+ printf("App activated\n");
+ } else {
+ printf("App iconified\n");
+ }
+ }
+ }
+ break;
+
+ case SDL_MOUSEBUTTONDOWN: {
+ Uint8 *keys;
+
+ keys = SDL_GetKeyState(NULL);
+ if ( keys[SDLK_ESCAPE] == SDL_PRESSED ) {
+ printf("Bye bye...\n");
+ exit(0);
+ }
+ printf("Mouse button pressed\n");
+ }
+ break;
+
+ case SDL_QUIT: {
+ printf("Quit requested, quitting.\n");
+ exit(0);
+ }
+ break;
+ }
+ }
+ /* This should never happen */
+ printf("SDL_WaitEvent error: %s\n", SDL_GetError());
+ exit(1);
+} Examples For the moment these examples are taken directly from the old SDL documentation. By the 1.2 release these examples should hopefully deal with most common SDL programming problems.
Input handling The first step in using a joystick in a SDL program is to initialize the Joystick subsystems of SDL. This done by passing the SDL_INIT_JOYSTICK flag to SDL_Init
Example 3-1. Initializing SDL with Joystick Support
if (SDL_Init( SDL_INIT_VIDEO | SDL_INIT_JOYSTICK ) < 0)
+ {
+ fprintf(stderr, "Couldn't initialize SDL: %s\n", SDL_GetError());
+ exit(1);
+ } This will attempt to start SDL with both the video and the joystick subsystems activated.
If we have reached this point then we can safely assume that the SDL library has been initialized and that the Joystick subsystem is active. We can now call some video and/or sound functions to get things going before we need the joystick. Eventually we have to make sure that there is actually a joystick to work with. It's wise to always check even if you know a joystick will be present on the system because it can also help detect when the joystick is unplugged. The function used to check for joysticks is SDL_NumJoysticks
This function simply returns the number of joysticks available on the system. If it is at least one then we are in good shape. The next step is to determine which joystick the user wants to use. If the number of joysticks available is only one then it is safe to assume that one joystick is the one the user wants to use. SDL has a function to get the name of the joysticks as assigned by the operations system and that function is SDL_JoystickName SDL_NumJoysticks - 1. In the demonstration a list of all available joysticks is printed to stdout.
Example 3-2. Querying the Number of Available Joysticks
printf("%i joysticks were found.\n\n", SDL_NumJoysticks() );
+ printf("The names of the joysticks are:\n");
+
+ for( i=0; i < SDL_NumJoysticks(); i++ )
+ {
+ printf(" %s\n", SDL_JoystickName(i));
+ } SDL's event driven architecture makes working with joysticks a snap. Joysticks can trigger 4 different types of events:
+
Events are received from all joysticks opened. The first thing that needs to be done in order to receive joystick events is to call SDL_JoystickEventState SDL_ENABLE flag. Next you must open the joysticks that you want to receive envents from. This is done with the SDL_JoystickOpen
Example 3-3. Opening a Joystick
SDL_Joystick *joystick;
+
+ SDL_JoystickEventState(SDL_ENABLE);
+ joystick = SDL_JoystickOpen(0); If we wanted to receive events for other joysticks we would open them with calls to SDL_JoystickOpen just like we opened joystick 0, except we would store the SDL_Joystick structure they return in a different pointer. We only need the joystick pointer when we are querying the joysticks or when we are closing the joystick.
Up to this point all the code we have is used just to initialize the joysticks in order to read values at run time. All we need now is an event loop, which is something that all SDL programs should have anyway to receive the systems quit events. We must now add code to check the event loop for at least some of the above mentioned events. Let's assume our event loop looks like this:
+
SDL_Event event;
+ /* Other initializtion code goes here */
+
+ /* Start main game loop here */
+
+ while(SDL_PollEvent(&event))
+ {
+ switch(event.type)
+ {
+ case SDL_KEYDOWN:
+ /* handle keyboard stuff here */
+ break;
+
+ case SDL_QUIT:
+ /* Set whatever flags are necessary to */
+ /* end the main game loop here */
+ break;
+ }
+ }
+
+ /* End loop here */
+To handle Joystick events we merely add cases for them, first we'll add axis handling code. Axis checks can get kinda of tricky because alot of the joystick events received are junk. Joystick axis have a tendency to vary just a little between polling due to the way they are designed. To compensate for this you have to set a threshold for changes and ignore the events that have'nt exceeded the threshold. 10% is usually a good threshold value. This sounds a lot more complicated than it is. Here is the Axis event handler:
Example 3-4. Joystick Axis Events
case SDL_JOYAXISMOTION: /* Handle Joystick Motion */
+ if ( ( event.jaxis.value < -3200 ) || (event.jaxis.value > 3200 ) )
+ {
+ /* code goes here */
+ }
+ break; Another trick with axis events is that up-down and left-right movement are two different sets of axes. The most important axis is axis 0 (left-right) and axis 1 (up-down). To handle them seperatly in the code we do the following:
Example 3-5. More Joystick Axis Events
case SDL_JOYAXISMOTION: /* Handle Joystick Motion */
+ if ( ( event.jaxis.value < -3200 ) || (event.jaxis.value > 3200 ) )
+ {
+ if( event.jaxis.axis == 0)
+ {
+ /* Left-right movement code goes here */
+ }
+
+ if( event.jaxis.axis == 1)
+ {
+ /* Up-Down movement code goes here */
+ }
+ }
+ break; Ideally the code here should use event.jaxis.value
If your joystick has any additional axis then they may be used for other sticks or throttle controls and those axis return values too just with different event.jaxis.axis
Button handling is simple compared to the axis checking.
Example 3-6. Joystick Button Events
case SDL_JOYBUTTONDOWN: /* Handle Joystick Button Presses */
+ if ( event.jbutton.button == 0 )
+ {
+ /* code goes here */
+ }
+ break; Button checks are simpler than axis checks because a button can only be pressed or not pressed. The SDL_JOYBUTTONDOWN event is triggered when a button is pressed and the SDL_JOYBUTTONUP event is fired when a button is released. We do have to know what button was pressed though, that is done by reading the event.jbutton.button
Lastly when we are through using our joysticks we should close them with a call to SDL_JoystickClose
SDL_JoystickClose(joystick); That takes care of the controls that you can count on being on every joystick under the sun, but there are a few extra things that SDL can support. Joyballs are next on our list, they are alot like axis with a few minor differences. Joyballs store relative changes unlike the the absolute postion stored in a axis event. Also one trackball event contains both the change in x and they change in y. Our case for it is as follows:
Example 3-7. Joystick Ball Events
case SDL_JOYBALLMOTION: /* Handle Joyball Motion */
+ if( event.jball.ball == 0 )
+ {
+ /* ball handling */
+ }
+ break; The above checks the first joyball on the joystick. The change in position will be stored in event.jball.xrel event.jball.yrel
Finally we have the hat event. Hats report only the direction they are pushed in. We check hat's position with the bitmasks:
+
+
SDL_HAT_CENTERED SDL_HAT_UP SDL_HAT_RIGHT SDL_HAT_DOWN SDL_HAT_LEFT
+
+Also there are some predefined combinations of the above:
+
SDL_HAT_RIGHTUP SDL_HAT_RIGHTDOWN SDL_HAT_LEFTUP SDL_HAT_LEFTDOWN
+
+Our case for the hat may resemble the following:
Example 3-8. Joystick Hat Events
case SDL_JOYHATMOTION: /* Handle Hat Motion */
+ if ( event.jhat.value & SDL_HAT_UP )
+ {
+ /* Do up stuff here */
+ }
+
+ if ( event.jhat.value & SDL_HAT_LEFT )
+ {
+ /* Do left stuff here */
+ }
+
+ if ( event.jhat.value & SDL_HAT_RIGHTDOWN )
+ {
+ /* Do right and down together stuff here */
+ }
+ break; In addition to the queries for number of joysticks on the system and their names there are additional functions to query the capabilities of attached joysticks:
+
+
+To use these functions we just have to pass in the joystick structure we got when we opened the joystick. For Example:
Example 3-9. Querying Joystick Characteristics
int number_of_buttons;
+ SDL_Joystick *joystick;
+
+ joystick = SDL_JoystickOpen(0);
+ number_of_buttons = SDL_JoystickNumButtons(joystick); This block of code would get the number of buttons on the first joystick in the system.
Handling the Keyboard SDL Library Documentation Prev Chapter 3. Input handling Next
It should make it a lot easier to understand this tutorial is you are familiar with the data types involved in keyboard access, so I'll explain them first.
SDLKey is an enumerated type defined in SDL/include/SDL_keysym.h and detailed here . Each SDLKey symbol represents a key, SDLK_a corresponds to the 'a' key on a keyboard, SDLK_SPACE corresponds to the space bar, and so on.
SDLMod is an enumerated type, similar to SDLKey , however it enumerates keyboard modifiers (Control, Alt, Shift). The full list of modifier symbols is here . SDLMod values can be AND'd together to represent several modifiers.
typedef struct{
+ Uint8 scancode;
+ SDLKey sym;
+ SDLMod mod;
+ Uint16 unicode;
+} SDL_keysym; The SDL_keysym structure describes a key press or a key release. The scancode sym SDLKey value of the key being pressed or released. The mod KMOD_NUM | KMOD_CAPS | KMOD_LSHIFT would mean that Numlock, Capslock and the left shift key were all press (or enabled in the case of the lock keys). Finally, the unicode
Note: It should be noted and understood that this field is only valid when the SDL_keysym is describing a key press, not a key release. Unicode values only make sense on a key press because the unicode value describes an international character and only key presses produce characters. More information on Unicode can be found at www.unicode.org
typedef struct{
+ Uint8 type;
+ Uint8 state;
+ SDL_keysym keysym;
+} SDL_KeyboardEvent; The SDL_KeyboardEvent describes a keyboard event (obviously). The key SDL_Event SDL_KeyboardEvent structure. The type SDL_KEYUP ) or a key press (SDL_KEYDOWN ) event. The state type SDL_RELEASED and SDL_PRESSED ). The keysym
Reading keybaord events from the event queue is quite simple (the event queue and using it is described here ). We read events using SDL_PollEvent while() loop and check for SDL_KEYUP and SDL_KEYDOWN events using a switch statement, like so:
Example 3-10. Reading Keyboard Events
SDL_Event event;
+ .
+ .
+ /* Poll for events. SDL_PollEvent() returns 0 when there are no */
+ /* more events on the event queue, our while loop will exit when */
+ /* that occurs. */
+ while( SDL_PollEvent( &event ) ){
+ /* We are only worried about SDL_KEYDOWN and SDL_KEYUP events */
+ switch( event.type ){
+ case SDL_KEYDOWN:
+ printf( "Key press detected\n" );
+ break;
+
+ case SDL_KEYUP:
+ printf( "Key release detected\n" );
+ break;
+
+ default:
+ break;
+ }
+ }
+ .
+ . This is a very basic example. No information about the key press or release is interpreted. We will explore the other extreme out our first full example below - reporting all available information about a keyboard event.
Before we can read events SDL must be initialised with SDL_Init SDL_SetVideoMode SDL_EnableUNICODE(1) and we must convert SDLKey values into something printable, using SDL_GetKeyName
Note: It is useful to note that unicode values < 0x80 translate directly a characters ASCII value. THis is used in the example below
Example 3-11. Interpreting Key Event Information
#include "SDL.h"
+
+ /* Function Prototypes */
+ void PrintKeyInfo( SDL_KeyboardEvent *key );
+ void PrintModifiers( SDLMod mod );
+
+ /* main */
+ int main( int argc, char *argv[] ){
+
+ SDL_Event event;
+ int quit = 0;
+
+ /* Initialise SDL */
+ if( SDL_Init( SDL_INIT_VIDEO ) < 0){
+ fprintf( stderr, "Could not initialise SDL: %s\n", SDL_GetError() );
+ exit( -1 );
+ }
+
+ /* Set a video mode */
+ if( !SDL_SetVideoMode( 320, 200, 0, 0 ) ){
+ fprintf( stderr, "Could not set video mode: %s\n", SDL_GetError() );
+ SDL_Quit();
+ exit( -1 );
+ }
+
+ /* Enable Unicode translation */
+ SDL_EnableUNICODE( 1 );
+
+ /* Loop until an SDL_QUIT event is found */
+ while( !quit ){
+
+ /* Poll for events */
+ while( SDL_PollEvent( &event ) ){
+
+ switch( event.type ){
+ /* Keyboard event */
+ /* Pass the event data onto PrintKeyInfo() */
+ case SDL_KEYDOWN:
+ case SDL_KEYUP:
+ PrintKeyInfo( &event.key );
+ break;
+
+ /* SDL_QUIT event (window close) */
+ case SDL_QUIT:
+ quit = 1;
+ break;
+
+ default:
+ break;
+ }
+
+ }
+
+ }
+
+ /* Clean up */
+ SDL_Quit();
+ exit( 0 );
+ }
+
+ /* Print all information about a key event */
+ void PrintKeyInfo( SDL_KeyboardEvent *key ){
+ /* Is it a release or a press? */
+ if( key->type == SDL_KEYUP )
+ printf( "Release:- " );
+ else
+ printf( "Press:- " );
+
+ /* Print the hardware scancode first */
+ printf( "Scancode: 0x%02X", key->keysym.scancode );
+ /* Print the name of the key */
+ printf( ", Name: %s", SDL_GetKeyName( key->keysym.sym ) );
+ /* We want to print the unicode info, but we need to make */
+ /* sure its a press event first (remember, release events */
+ /* don't have unicode info */
+ if( key->type == SDL_KEYDOWN ){
+ /* If the Unicode value is less than 0x80 then the */
+ /* unicode value can be used to get a printable */
+ /* representation of the key, using (char)unicode. */
+ printf(", Unicode: " );
+ if( key->keysym.unicode < 0x80 && key->keysym.unicode > 0 ){
+ printf( "%c (0x%04X)", (char)key->keysym.unicode,
+ key->keysym.unicode );
+ }
+ else{
+ printf( "? (0x%04X)", key->keysym.unicode );
+ }
+ }
+ printf( "\n" );
+ /* Print modifier info */
+ PrintModifiers( key->keysym.mod );
+ }
+
+ /* Print modifier info */
+ void PrintModifiers( SDLMod mod ){
+ printf( "Modifers: " );
+
+ /* If there are none then say so and return */
+ if( mod == KMOD_NONE ){
+ printf( "None\n" );
+ return;
+ }
+
+ /* Check for the presence of each SDLMod value */
+ /* This looks messy, but there really isn't */
+ /* a clearer way. */
+ if( mod & KMOD_NUM ) printf( "NUMLOCK " );
+ if( mod & KMOD_CAPS ) printf( "CAPSLOCK " );
+ if( mod & KMOD_LCTRL ) printf( "LCTRL " );
+ if( mod & KMOD_RCTRL ) printf( "RCTRL " );
+ if( mod & KMOD_RSHIFT ) printf( "RSHIFT " );
+ if( mod & KMOD_LSHIFT ) printf( "LSHIFT " );
+ if( mod & KMOD_RALT ) printf( "RALT " );
+ if( mod & KMOD_LALT ) printf( "LALT " );
+ if( mod & KMOD_CTRL ) printf( "CTRL " );
+ if( mod & KMOD_SHIFT ) printf( "SHIFT " );
+ if( mod & KMOD_ALT ) printf( "ALT " );
+ printf( "\n" );
+ } I have found that people using keyboard events for games and other interactive applications don't always understand one fundemental point.
Keyboard events only
Imagine you have an image of an alien that you wish to move around using the cursor keys: when you pressed the left arrow key you want him to slide over to the left, and when you press the down key you want him to slide down the screen. Examine the following code; it highlights an error that many people have made.
+
/* Alien screen coordinates */
+ int alien_x=0, alien_y=0;
+ .
+ .
+ /* Initialise SDL and video modes and all that */
+ .
+ /* Main game loop */
+ /* Check for events */
+ while( SDL_PollEvent( &event ) ){
+ switch( event.type ){
+ /* Look for a keypress */
+ case SDL_KEYDOWN:
+ /* Check the SDLKey values and move change the coords */
+ switch( event.key.keysym.sym ){
+ case SDLK_LEFT:
+ alien_x -= 1;
+ break;
+ case SDLK_RIGHT:
+ alien_x += 1;
+ break;
+ case SDLK_UP:
+ alien_y -= 1;
+ break;
+ case SDLK_DOWN:
+ alien_y += 1;
+ break;
+ default:
+ break;
+ }
+ }
+ }
+ }
+ .
+ .
+At first glance you may think this is a perfectly reasonable piece of code for the task, but it isn't. Like I said keyboard events only occur when a key changes state, so the user would have to press and release the left cursor key 100 times to move the alien 100 pixels to the left.
To get around this problem we must not use the events to change the position of the alien, we use the events to set flags which are then used in a seperate section of code to move the alien. Something like this:
Example 3-12. Proper Game Movement
/* Alien screen coordinates */
+ int alien_x=0, alien_y=0;
+ int alien_xvel=0, alien_yvel=0;
+ .
+ .
+ /* Initialise SDL and video modes and all that */
+ .
+ /* Main game loop */
+ /* Check for events */
+ while( SDL_PollEvent( &event ) ){
+ switch( event.type ){
+ /* Look for a keypress */
+ case SDL_KEYDOWN:
+ /* Check the SDLKey values and move change the coords */
+ switch( event.key.keysym.sym ){
+ case SDLK_LEFT:
+ alien_xvel = -1;
+ break;
+ case SDLK_RIGHT:
+ alien_xvel = 1;
+ break;
+ case SDLK_UP:
+ alien_yvel = -1;
+ break;
+ case SDLK_DOWN:
+ alien_yvel = 1;
+ break;
+ default:
+ break;
+ }
+ break;
+ /* We must also use the SDL_KEYUP events to zero the x */
+ /* and y velocity variables. But we must also be */
+ /* careful not to zero the velocities when we shouldn't*/
+ case SDL_KEYUP:
+ switch( event.key.keysym.sym ){
+ case SDLK_LEFT:
+ /* We check to make sure the alien is moving */
+ /* to the left. If it is then we zero the */
+ /* velocity. If the alien is moving to the */
+ /* right then the right key is still press */
+ /* so we don't tocuh the velocity */
+ if( alien_xvel < 0 )
+ alien_xvel = 0;
+ break;
+ case SDLK_RIGHT:
+ if( alien_xvel > 0 )
+ alien_xvel = 0;
+ break;
+ case SDLK_UP:
+ if( alien_yvel < 0 )
+ alien_yvel = 0;
+ break;
+ case SDLK_DOWN:
+ if( alien_yvel > 0 )
+ alien_yvel = 0;
+ break;
+ default:
+ break;
+ }
+ break;
+
+ default:
+ break;
+ }
+ }
+ .
+ .
+ /* Update the alien position */
+ alien_x += alien_xvel;
+ alien_y += alien_yvel; As can be seen, we use two extra variables, alien_xvel and alien_yvel, which represent the motion of the ship, it is these variables that we update when we detect keypresses and releases.
Preface The SDL library is designed to make it easy to write games that run on Linux, *BSD, MacOS, Win32 and BeOS using the various native high-performance media interfaces, (for video, audio, etc) and presenting a single source-code level API to your application. SDL is a fairly low level API, but using it, completely portable applications can be written with a great deal of flexibility.
The Basics The SDL Guide section is pretty incomplete. If you feel you have anything to add mail akawaka@skynet.ie or visit http://akawaka.csn.ul.ie/tne/.
Time Examples SDL Library Documentation Prev Chapter 4. Examples Next
#define TICK_INTERVAL 30
+
+static Uint32 next_time;
+
+Uint32 time_left(void)
+{
+ Uint32 now;
+
+ now = SDL_GetTicks();
+ if(next_time <= now)
+ return 0;
+ else
+ return next_time - now;
+}
+
+
+/* main game loop */
+
+ next_time = SDL_GetTicks() + TICK_INTERVAL;
+ while ( game_running ) {
+ update_game_state();
+ SDL_Delay(time_left());
+ next_time += TICK_INTERVAL;
+ }
Graphics and Video Video is probably the most common thing that SDL is used for, and
+so it has the most complete subsystem. Here are a few
+examples to demonstrate the basics.
This is what almost all SDL programs have to do in one way or
+another.
Example 2-1. Initializing the Video Display
SDL_Surface *screen;
+
+ /* Initialize the SDL library */
+ if( SDL_Init(SDL_INIT_VIDEO) < 0 ) {
+ fprintf(stderr,
+ "Couldn't initialize SDL: %s\n", SDL_GetError());
+ exit(1);
+ }
+
+ /* Clean up on exit */
+ atexit(SDL_Quit);
+
+ /*
+ * Initialize the display in a 640x480 8-bit palettized mode,
+ * requesting a software surface
+ */
+ screen = SDL_SetVideoMode(640, 480, 8, SDL_SWSURFACE);
+ if ( screen == NULL ) {
+ fprintf(stderr, "Couldn't set 640x480x8 video mode: %s\n",
+ SDL_GetError());
+ exit(1);
+ } If you have a preference for a certain pixel depth but will accept any
+other, use SDL_SetVideoMode with SDL_ANYFORMAT as below. You can also
+use SDL_VideoModeOK() to find the native video mode that is closest to
+the mode you request.
Example 2-2. Initializing the Best Video Mode
/* Have a preference for 8-bit, but accept any depth */
+ screen = SDL_SetVideoMode(640, 480, 8, SDL_SWSURFACE|SDL_ANYFORMAT);
+ if ( screen == NULL ) {
+ fprintf(stderr, "Couldn't set 640x480x8 video mode: %s\n",
+ SDL_GetError());
+ exit(1);
+ }
+ printf("Set 640x480 at %d bits-per-pixel mode\n",
+ screen->format->BitsPerPixel); The following function loads and displays a BMP file given as
+argument, once SDL is initialised and a video mode has been set.
Example 2-3. Loading and Displaying a BMP File
void display_bmp(char *file_name)
+{
+ SDL_Surface *image;
+
+ /* Load the BMP file into a surface */
+ image = SDL_LoadBMP(file_name);
+ if (image == NULL) {
+ fprintf(stderr, "Couldn't load %s: %s\n", file_name, SDL_GetError());
+ return;
+ }
+
+ /*
+ * Palettized screen modes will have a default palette (a standard
+ * 8*8*4 colour cube), but if the image is palettized as well we can
+ * use that palette for a nicer colour matching
+ */
+ if (image->format->palette && screen->format->palette) {
+ SDL_SetColors(screen, image->format->palette->colors, 0,
+ image->format->palette->ncolors);
+ }
+
+ /* Blit onto the screen surface */
+ if(SDL_BlitSurface(image, NULL, screen, NULL) < 0)
+ fprintf(stderr, "BlitSurface error: %s\n", SDL_GetError());
+
+ SDL_UpdateRect(screen, 0, 0, image->w, image->h);
+
+ /* Free the allocated BMP surface */
+ SDL_FreeSurface(image);
+} The following two functions can be used to get and set single
+pixels of a surface. They are carefully written to work with any depth
+currently supported by SDL. Remember to lock the surface before
+calling them, and to unlock it before calling any other SDL
+functions.
To convert between pixel values and their red, green, blue
+components, use SDL_GetRGB() and SDL_MapRGB().
Example 2-4. getpixel()
/*
+ * Return the pixel value at (x, y)
+ * NOTE: The surface must be locked before calling this!
+ */
+Uint32 getpixel(SDL_Surface *surface, int x, int y)
+{
+ int bpp = surface->format->BytesPerPixel;
+ /* Here p is the address to the pixel we want to retrieve */
+ Uint8 *p = (Uint8 *)surface->pixels + y * surface->pitch + x * bpp;
+
+ switch(bpp) {
+ case 1:
+ return *p;
+
+ case 2:
+ return *(Uint16 *)p;
+
+ case 3:
+ if(SDL_BYTEORDER == SDL_BIG_ENDIAN)
+ return p[0] << 16 | p[1] << 8 | p[2];
+ else
+ return p[0] | p[1] << 8 | p[2] << 16;
+
+ case 4:
+ return *(Uint32 *)p;
+
+ default:
+ return 0; /* shouldn't happen, but avoids warnings */
+ }
+} Example 2-5. putpixel()
/*
+ * Set the pixel at (x, y) to the given value
+ * NOTE: The surface must be locked before calling this!
+ */
+void putpixel(SDL_Surface *surface, int x, int y, Uint32 pixel)
+{
+ int bpp = surface->format->BytesPerPixel;
+ /* Here p is the address to the pixel we want to set */
+ Uint8 *p = (Uint8 *)surface->pixels + y * surface->pitch + x * bpp;
+
+ switch(bpp) {
+ case 1:
+ *p = pixel;
+ break;
+
+ case 2:
+ *(Uint16 *)p = pixel;
+ break;
+
+ case 3:
+ if(SDL_BYTEORDER == SDL_BIG_ENDIAN) {
+ p[0] = (pixel >> 16) & 0xff;
+ p[1] = (pixel >> 8) & 0xff;
+ p[2] = pixel & 0xff;
+ } else {
+ p[0] = pixel & 0xff;
+ p[1] = (pixel >> 8) & 0xff;
+ p[2] = (pixel >> 16) & 0xff;
+ }
+ break;
+
+ case 4:
+ *(Uint32 *)p = pixel;
+ break;
+ }
+} The following code uses the putpixel() function above to set a
+yellow pixel in the middle of the screen.
Example 2-6. Using putpixel()
/* Code to set a yellow pixel at the center of the screen */
+
+ int x, y;
+ Uint32 yellow;
+
+ /* Map the color yellow to this display (R=0xff, G=0xFF, B=0x00)
+ Note: If the display is palettized, you must set the palette first.
+ */
+ yellow = SDL_MapRGB(screen->format, 0xff, 0xff, 0x00);
+
+ x = screen->w / 2;
+ y = screen->h / 2;
+
+ /* Lock the screen for direct access to the pixels */
+ if ( SDL_MUSTLOCK(screen) ) {
+ if ( SDL_LockSurface(screen) < 0 ) {
+ fprintf(stderr, "Can't lock screen: %s\n", SDL_GetError());
+ return;
+ }
+ }
+
+ putpixel(screen, x, y, yellow);
+
+ if ( SDL_MUSTLOCK(screen) ) {
+ SDL_UnlockSurface(screen);
+ }
+ /* Update just the part of the display that we've changed */
+ SDL_UpdateRect(screen, x, y, 1, 1);
+
+ return;
Using OpenGL With SDL SDL Library Documentation Prev Chapter 2. Graphics and Video Next
SDL has the ability to create and use OpenGL contexts on several platforms(Linux/X11, Win32, BeOS, MacOS Classic/Toolbox, Mac OS X, FreeBSD/X11 and Solaris/X11). This allows you to use SDL's audio, event handling, threads and times in your OpenGL applications (a function often performed by GLUT).
Initialising SDL to use OpenGL is not very different to initialising SDL normally. There are three differences; you must pass SDL_OPENGL to SDL_SetVideoMode SDL_GL_SetAttribute not SDL_DOUBLEBUF flag to SDL_SetVideoMode .
Example 2-7. Initializing SDL with OpenGL
/* Information about the current video settings. */
+ const SDL_VideoInfo* info = NULL;
+ /* Dimensions of our window. */
+ int width = 0;
+ int height = 0;
+ /* Color depth in bits of our window. */
+ int bpp = 0;
+ /* Flags we will pass into SDL_SetVideoMode. */
+ int flags = 0;
+
+ /* First, initialize SDL's video subsystem. */
+ if( SDL_Init( SDL_INIT_VIDEO ) < 0 ) {
+ /* Failed, exit. */
+ fprintf( stderr, "Video initialization failed: %s\n",
+ SDL_GetError( ) );
+ quit_tutorial( 1 );
+ }
+
+ /* Let's get some video information. */
+ info = SDL_GetVideoInfo( );
+
+ if( !info ) {
+ /* This should probably never happen. */
+ fprintf( stderr, "Video query failed: %s\n",
+ SDL_GetError( ) );
+ quit_tutorial( 1 );
+ }
+
+ /*
+ * Set our width/height to 640/480 (you would
+ * of course let the user decide this in a normal
+ * app). We get the bpp we will request from
+ * the display. On X11, VidMode can't change
+ * resolution, so this is probably being overly
+ * safe. Under Win32, ChangeDisplaySettings
+ * can change the bpp.
+ */
+ width = 640;
+ height = 480;
+ bpp = info->vfmt->BitsPerPixel;
+
+ /*
+ * Now, we want to setup our requested
+ * window attributes for our OpenGL window.
+ * We want *at least* 5 bits of red, green
+ * and blue. We also want at least a 16-bit
+ * depth buffer.
+ *
+ * The last thing we do is request a double
+ * buffered window. '1' turns on double
+ * buffering, '0' turns it off.
+ *
+ * Note that we do not use SDL_DOUBLEBUF in
+ * the flags to SDL_SetVideoMode. That does
+ * not affect the GL attribute state, only
+ * the standard 2D blitting setup.
+ */
+ SDL_GL_SetAttribute( SDL_GL_RED_SIZE, 5 );
+ SDL_GL_SetAttribute( SDL_GL_GREEN_SIZE, 5 );
+ SDL_GL_SetAttribute( SDL_GL_BLUE_SIZE, 5 );
+ SDL_GL_SetAttribute( SDL_GL_DEPTH_SIZE, 16 );
+ SDL_GL_SetAttribute( SDL_GL_DOUBLEBUFFER, 1 );
+
+ /*
+ * We want to request that SDL provide us
+ * with an OpenGL window, in a fullscreen
+ * video mode.
+ *
+ * EXERCISE:
+ * Make starting windowed an option, and
+ * handle the resize events properly with
+ * glViewport.
+ */
+ flags = SDL_OPENGL | SDL_FULLSCREEN;
+
+ /*
+ * Set the video mode
+ */
+ if( SDL_SetVideoMode( width, height, bpp, flags ) == 0 ) {
+ /*
+ * This could happen for a variety of reasons,
+ * including DISPLAY not being set, the specified
+ * resolution not being available, etc.
+ */
+ fprintf( stderr, "Video mode set failed: %s\n",
+ SDL_GetError( ) );
+ quit_tutorial( 1 );
+ } Apart from initialisation, using OpenGL within SDL is the same as using OpenGL
+with any other API, e.g. GLUT. You still use all the same function calls and
+data types. However if you are using a double-buffered display, then you must
+use
+SDL_GL_SwapBuffers() SDL_GL_SetAttribute SDL_GL_DOUBLEBUFFER , and use
+SDL_GL_GetAttribute
A full example code listing is now presented below.
Example 2-8. SDL and OpenGL
/*
+ * SDL OpenGL Tutorial.
+ * (c) Michael Vance, 2000
+ * briareos@lokigames.com
+ *
+ * Distributed under terms of the LGPL.
+ */
+
+#include <SDL/SDL.h>
+#include <GL/gl.h>
+#include <GL/glu.h>
+
+#include <stdio.h>
+#include <stdlib.h>
+
+static GLboolean should_rotate = GL_TRUE;
+
+static void quit_tutorial( int code )
+{
+ /*
+ * Quit SDL so we can release the fullscreen
+ * mode and restore the previous video settings,
+ * etc.
+ */
+ SDL_Quit( );
+
+ /* Exit program. */
+ exit( code );
+}
+
+static void handle_key_down( SDL_keysym* keysym )
+{
+
+ /*
+ * We're only interested if 'Esc' has
+ * been presssed.
+ *
+ * EXERCISE:
+ * Handle the arrow keys and have that change the
+ * viewing position/angle.
+ */
+ switch( keysym->sym ) {
+ case SDLK_ESCAPE:
+ quit_tutorial( 0 );
+ break;
+ case SDLK_SPACE:
+ should_rotate = !should_rotate;
+ break;
+ default:
+ break;
+ }
+
+}
+
+static void process_events( void )
+{
+ /* Our SDL event placeholder. */
+ SDL_Event event;
+
+ /* Grab all the events off the queue. */
+ while( SDL_PollEvent( &event ) ) {
+
+ switch( event.type ) {
+ case SDL_KEYDOWN:
+ /* Handle key presses. */
+ handle_key_down( &event.key.keysym );
+ break;
+ case SDL_QUIT:
+ /* Handle quit requests (like Ctrl-c). */
+ quit_tutorial( 0 );
+ break;
+ }
+
+ }
+
+}
+
+static void draw_screen( void )
+{
+ /* Our angle of rotation. */
+ static float angle = 0.0f;
+
+ /*
+ * EXERCISE:
+ * Replace this awful mess with vertex
+ * arrays and a call to glDrawElements.
+ *
+ * EXERCISE:
+ * After completing the above, change
+ * it to use compiled vertex arrays.
+ *
+ * EXERCISE:
+ * Verify my windings are correct here ;).
+ */
+ static GLfloat v0[] = { -1.0f, -1.0f, 1.0f };
+ static GLfloat v1[] = { 1.0f, -1.0f, 1.0f };
+ static GLfloat v2[] = { 1.0f, 1.0f, 1.0f };
+ static GLfloat v3[] = { -1.0f, 1.0f, 1.0f };
+ static GLfloat v4[] = { -1.0f, -1.0f, -1.0f };
+ static GLfloat v5[] = { 1.0f, -1.0f, -1.0f };
+ static GLfloat v6[] = { 1.0f, 1.0f, -1.0f };
+ static GLfloat v7[] = { -1.0f, 1.0f, -1.0f };
+ static GLubyte red[] = { 255, 0, 0, 255 };
+ static GLubyte green[] = { 0, 255, 0, 255 };
+ static GLubyte blue[] = { 0, 0, 255, 255 };
+ static GLubyte white[] = { 255, 255, 255, 255 };
+ static GLubyte yellow[] = { 0, 255, 255, 255 };
+ static GLubyte black[] = { 0, 0, 0, 255 };
+ static GLubyte orange[] = { 255, 255, 0, 255 };
+ static GLubyte purple[] = { 255, 0, 255, 0 };
+
+ /* Clear the color and depth buffers. */
+ glClear( GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT );
+
+ /* We don't want to modify the projection matrix. */
+ glMatrixMode( GL_MODELVIEW );
+ glLoadIdentity( );
+
+ /* Move down the z-axis. */
+ glTranslatef( 0.0, 0.0, -5.0 );
+
+ /* Rotate. */
+ glRotatef( angle, 0.0, 1.0, 0.0 );
+
+ if( should_rotate ) {
+
+ if( ++angle > 360.0f ) {
+ angle = 0.0f;
+ }
+
+ }
+
+ /* Send our triangle data to the pipeline. */
+ glBegin( GL_TRIANGLES );
+
+ glColor4ubv( red );
+ glVertex3fv( v0 );
+ glColor4ubv( green );
+ glVertex3fv( v1 );
+ glColor4ubv( blue );
+ glVertex3fv( v2 );
+
+ glColor4ubv( red );
+ glVertex3fv( v0 );
+ glColor4ubv( blue );
+ glVertex3fv( v2 );
+ glColor4ubv( white );
+ glVertex3fv( v3 );
+
+ glColor4ubv( green );
+ glVertex3fv( v1 );
+ glColor4ubv( black );
+ glVertex3fv( v5 );
+ glColor4ubv( orange );
+ glVertex3fv( v6 );
+
+ glColor4ubv( green );
+ glVertex3fv( v1 );
+ glColor4ubv( orange );
+ glVertex3fv( v6 );
+ glColor4ubv( blue );
+ glVertex3fv( v2 );
+
+ glColor4ubv( black );
+ glVertex3fv( v5 );
+ glColor4ubv( yellow );
+ glVertex3fv( v4 );
+ glColor4ubv( purple );
+ glVertex3fv( v7 );
+
+ glColor4ubv( black );
+ glVertex3fv( v5 );
+ glColor4ubv( purple );
+ glVertex3fv( v7 );
+ glColor4ubv( orange );
+ glVertex3fv( v6 );
+
+ glColor4ubv( yellow );
+ glVertex3fv( v4 );
+ glColor4ubv( red );
+ glVertex3fv( v0 );
+ glColor4ubv( white );
+ glVertex3fv( v3 );
+
+ glColor4ubv( yellow );
+ glVertex3fv( v4 );
+ glColor4ubv( white );
+ glVertex3fv( v3 );
+ glColor4ubv( purple );
+ glVertex3fv( v7 );
+
+ glColor4ubv( white );
+ glVertex3fv( v3 );
+ glColor4ubv( blue );
+ glVertex3fv( v2 );
+ glColor4ubv( orange );
+ glVertex3fv( v6 );
+
+ glColor4ubv( white );
+ glVertex3fv( v3 );
+ glColor4ubv( orange );
+ glVertex3fv( v6 );
+ glColor4ubv( purple );
+ glVertex3fv( v7 );
+
+ glColor4ubv( green );
+ glVertex3fv( v1 );
+ glColor4ubv( red );
+ glVertex3fv( v0 );
+ glColor4ubv( yellow );
+ glVertex3fv( v4 );
+
+ glColor4ubv( green );
+ glVertex3fv( v1 );
+ glColor4ubv( yellow );
+ glVertex3fv( v4 );
+ glColor4ubv( black );
+ glVertex3fv( v5 );
+
+ glEnd( );
+
+ /*
+ * EXERCISE:
+ * Draw text telling the user that 'Spc'
+ * pauses the rotation and 'Esc' quits.
+ * Do it using vetors and textured quads.
+ */
+
+ /*
+ * Swap the buffers. This this tells the driver to
+ * render the next frame from the contents of the
+ * back-buffer, and to set all rendering operations
+ * to occur on what was the front-buffer.
+ *
+ * Double buffering prevents nasty visual tearing
+ * from the application drawing on areas of the
+ * screen that are being updated at the same time.
+ */
+ SDL_GL_SwapBuffers( );
+}
+
+static void setup_opengl( int width, int height )
+{
+ float ratio = (float) width / (float) height;
+
+ /* Our shading model--Gouraud (smooth). */
+ glShadeModel( GL_SMOOTH );
+
+ /* Culling. */
+ glCullFace( GL_BACK );
+ glFrontFace( GL_CCW );
+ glEnable( GL_CULL_FACE );
+
+ /* Set the clear color. */
+ glClearColor( 0, 0, 0, 0 );
+
+ /* Setup our viewport. */
+ glViewport( 0, 0, width, height );
+
+ /*
+ * Change to the projection matrix and set
+ * our viewing volume.
+ */
+ glMatrixMode( GL_PROJECTION );
+ glLoadIdentity( );
+ /*
+ * EXERCISE:
+ * Replace this with a call to glFrustum.
+ */
+ gluPerspective( 60.0, ratio, 1.0, 1024.0 );
+}
+
+int main( int argc, char* argv[] )
+{
+ /* Information about the current video settings. */
+ const SDL_VideoInfo* info = NULL;
+ /* Dimensions of our window. */
+ int width = 0;
+ int height = 0;
+ /* Color depth in bits of our window. */
+ int bpp = 0;
+ /* Flags we will pass into SDL_SetVideoMode. */
+ int flags = 0;
+
+ /* First, initialize SDL's video subsystem. */
+ if( SDL_Init( SDL_INIT_VIDEO ) < 0 ) {
+ /* Failed, exit. */
+ fprintf( stderr, "Video initialization failed: %s\n",
+ SDL_GetError( ) );
+ quit_tutorial( 1 );
+ }
+
+ /* Let's get some video information. */
+ info = SDL_GetVideoInfo( );
+
+ if( !info ) {
+ /* This should probably never happen. */
+ fprintf( stderr, "Video query failed: %s\n",
+ SDL_GetError( ) );
+ quit_tutorial( 1 );
+ }
+
+ /*
+ * Set our width/height to 640/480 (you would
+ * of course let the user decide this in a normal
+ * app). We get the bpp we will request from
+ * the display. On X11, VidMode can't change
+ * resolution, so this is probably being overly
+ * safe. Under Win32, ChangeDisplaySettings
+ * can change the bpp.
+ */
+ width = 640;
+ height = 480;
+ bpp = info->vfmt->BitsPerPixel;
+
+ /*
+ * Now, we want to setup our requested
+ * window attributes for our OpenGL window.
+ * We want *at least* 5 bits of red, green
+ * and blue. We also want at least a 16-bit
+ * depth buffer.
+ *
+ * The last thing we do is request a double
+ * buffered window. '1' turns on double
+ * buffering, '0' turns it off.
+ *
+ * Note that we do not use SDL_DOUBLEBUF in
+ * the flags to SDL_SetVideoMode. That does
+ * not affect the GL attribute state, only
+ * the standard 2D blitting setup.
+ */
+ SDL_GL_SetAttribute( SDL_GL_RED_SIZE, 5 );
+ SDL_GL_SetAttribute( SDL_GL_GREEN_SIZE, 5 );
+ SDL_GL_SetAttribute( SDL_GL_BLUE_SIZE, 5 );
+ SDL_GL_SetAttribute( SDL_GL_DEPTH_SIZE, 16 );
+ SDL_GL_SetAttribute( SDL_GL_DOUBLEBUFFER, 1 );
+
+ /*
+ * We want to request that SDL provide us
+ * with an OpenGL window, in a fullscreen
+ * video mode.
+ *
+ * EXERCISE:
+ * Make starting windowed an option, and
+ * handle the resize events properly with
+ * glViewport.
+ */
+ flags = SDL_OPENGL | SDL_FULLSCREEN;
+
+ /*
+ * Set the video mode
+ */
+ if( SDL_SetVideoMode( width, height, bpp, flags ) == 0 ) {
+ /*
+ * This could happen for a variety of reasons,
+ * including DISPLAY not being set, the specified
+ * resolution not being available, etc.
+ */
+ fprintf( stderr, "Video mode set failed: %s\n",
+ SDL_GetError( ) );
+ quit_tutorial( 1 );
+ }
+
+ /*
+ * At this point, we should have a properly setup
+ * double-buffered window for use with OpenGL.
+ */
+ setup_opengl( width, height );
+
+ /*
+ * Now we want to begin our normal app process--
+ * an event loop with a lot of redrawing.
+ */
+ while( 1 ) {
+ /* Process incoming events. */
+ process_events( );
+ /* Draw the screen. */
+ draw_screen( );
+ }
+
+ /*
+ * EXERCISE:
+ * Record timings using SDL_GetTicks() and
+ * and print out frames per second at program
+ * end.
+ */
+
+ /* Never reached. */
+ return 0;
+} Joystick Joysticks, and other similar input devices, have a very strong role in game playing and SDL provides comprehensive support for them. Axes, Buttons, POV Hats and trackballs are all supported.
Joystick support is initialized by passed the SDL_INIT_JOYSTICK flag to SDL_Init SDL_JoystickOpen
While using the functions describe in this secton may seem like the best way to access and read from joysticks, in most cases they aren't. Ideally joysticks should be read using the event system. To enable this, you must set the joystick event processing state with SDL_JoystickEventState opened before they can be used of course.
Note: If you are not SDL_JoystickUpdate
Note: Force Feedback is not yet support. Sam (slouken@libsdl.org) is soliciting suggestions from people with force-feedback experience on the best wat to desgin the API.
SDL Reference SDL_ActiveEvent Name SDL_ActiveEvent -- Application visibility event structure
Structure Definition typedef struct{
+ Uint8 type;
+ Uint8 gain;
+ Uint8 state;
+} SDL_ActiveEvent; Structure Data
type SDL_ACTIVEEVENT. gain 0 if the event is a loss or 1 if it is a gain. state SDL_APPMOUSEFOCUS if mouse focus was gained or lost, SDL_APPINPUTFOCUS if input focus was gained or lost, or SDL_APPACTIVE if the application was iconified (gain gain
Description SDL_ActiveEvent is a member of the SDL_Event SDL_ACTIVEEVENT is reported.
When the mouse leaves or enters the window area a SDL_APPMOUSEFOCUS type activation event occurs, if the mouse entered the window then gain gain SDL_APPINPUTFOCUS type activation event occurs when the application loses or gains keyboard focus. This usually occurs when another application is made active. Finally, a SDL_APPACTIVE type event occurs when the application is either minimised/iconified (gain
Note: This event does not occur when an application window is first created.
SDL_AddTimer Name SDL_AddTimer -- Add a timer which will call a callback after the specified number of milliseconds has
+elapsed.
Synopsis
#include "SDL.h" SDL_TimerID SDL_AddTimer (Uint32 interval, SDL_NewTimerCallback callback, void *param);
Callback /* type definition for the "new" timer callback function */
+typedef Uint32 (*SDL_NewTimerCallback)(Uint32 interval, void *param); Description Adds a callback function to be run after the specified number of
+milliseconds has elapsed. The callback function is passed the current
+timer interval and the user supplied parameter from the
+SDL_AddTimer call and returns the next timer
+interval. If the returned value from the callback is the same as the one
+passed in, the periodic alarm continues, otherwise a new alarm is
+scheduled.
To cancel a currently running timer call
+SDL_RemoveTimer with the
+timer ID returned from
+SDL_AddTimer .
The timer callback function may run in a different thread than your
+main program, and so shouldn't call any functions from within itself.
+You may always call SDL_PushEvent , however.
The granularity of the timer is platform-dependent, but you should count
+on it being at least 10 ms as this is the most common number.
+This means that if
+you request a 16 ms timer, your callback will run approximately 20 ms
+later on an unloaded system. If you wanted to set a flag signaling
+a frame update at 30 frames per second (every 33 ms), you might set a
+timer for 30 ms (see example below).
+
+If you use this function, you need to pass SDL_INIT_TIMER
+to SDL_Init .
Return Value Returns an ID value for the added timer or
+NULL if there was an error.
Examples
my_timer_id = SDL_AddTimer((33/10)*10, my_callbackfunc, my_callback_param); SDL_AudioCVT Name SDL_AudioCVT -- Audio Conversion Structure
Structure Definition typedef struct{
+ int needed;
+ Uint16 src_format;
+ Uint16 dest_format;
+ double rate_incr;
+ Uint8 *buf;
+ int len;
+ int len_cvt;
+ int len_mult;
+ double len_ratio;
+ void (*filters[10])(struct SDL_AudioCVT *cvt, Uint16 format);
+ int filter_index;
+} SDL_AudioCVT; Structure Data
needed Set to one if the conversion is possible src_format Audio format of the source dest_format Audio format of the destination rate_incr Rate conversion increment buf Audio buffer len Length of the original audio buffer in bytes len_cvt Length of converted audio buffer in bytes (calculated) len_mult buf len len_mult len_ratio Final audio size is len len_ratio filters[10](..) Pointers to functions needed for this conversion filter_index Current conversion function
Description The SDL_AudioCVT is used to convert audio data between different formats. A SDL_AudioCVT structure is created with the SDL_BuildAudioCVT SDL_ConvertAudio
Many of the fields in the SDL_AudioCVT structure should be considered private and their function will not be discussed here.
Uint8 * buf This points to the audio data that will be used in the conversion. It is both the source and the destination, which means the converted audio data overwrites the original data. It also means that the converted data may be larger than the original data (if you were converting from 8-bit to 16-bit, for instance), so you must ensure buf
int len This is the length of the original audio data in bytes.
int len_mult As explained above, the audio buffer needs to be big enough to store the converted data, which may be bigger than the original audio data. The length of buf len len_mult
double len_ratio When you have finished converting your audio data, you need to know how much of your audio buffer is valid. len len_ratio len_mult len_mult len_ratio
SDL_AudioSpec Name SDL_AudioSpec -- Audio Specification Structure
Structure Definition typedef struct{
+ int freq;
+ Uint16 format;
+ Uint8 channels;
+ Uint8 silence;
+ Uint16 samples;
+ Uint32 size;
+ void (*callback)(void *userdata, Uint8 *stream, int len);
+ void *userdata;
+} SDL_AudioSpec; Structure Data
freq Audio frequency in samples per second format Audio data format channels Number of channels: 1 mono, 2 stereo silence Audio buffer silence value (calculated) samples Audio buffer size in samples size Audio buffer size in bytes (calculated) callback(..) Callback function for filling the audio buffer userdata Pointer the user data which is passed to the callback function
Description The SDL_AudioSpec structure is used to describe the format of some audio data. This structure is used by SDL_OpenAudio SDL_LoadWAV SDL_OpenAudio only freq format samples channels SDL_LoadWAV . We will detail these common members here.
freq The number of samples sent to the sound device every second. Common values are 11025, 22050 and 44100. The higher the better.
format Specifies the size and type of each sample element
+
AUDIO_U8 Unsigned 8-bit samples
AUDIO_S8 Signed 8-bit samples
AUDIO_U16 or AUDIO_U16LSB Unsigned 16-bit little-endian samples
AUDIO_S16 or AUDIO_S16LSB Signed 16-bit little-endian samples
AUDIO_U16MSB Unsigned 16-bit big-endian samples
AUDIO_S16MSB Signed 16-bit big-endian samples
AUDIO_U16SYS Either AUDIO_U16LSB or AUDIO_U16MSB depending on you systems endianness
AUDIO_S16SYS Either AUDIO_S16LSB or AUDIO_S16MSB depending on you systems endianness
channels The number of seperate sound channels. 1 is mono (single channel), 2 is stereo (dual channel). samples When used with SDL_OpenAudio format SDL_AudioSpec is used with SDL_LoadWAV samples
SDL_BlitSurface Name SDL_BlitSurface -- This performs a fast blit from the source surface to the destination surface.
Synopsis
#include "SDL.h" int SDL_BlitSurface (SDL_Surface *src, SDL_Rect *srcrect, SDL_Surface *dst, SDL_Rect *dstrect);
Description This performs a fast blit from the source surface to the destination surface.
The width and height in srcrect dstrect
If srcrect NULL , the
+entire surface is copied. If dstrect NULL , then the destination position (upper left
+corner) is (0, 0).
The final blit rectangle is saved in
+dstrect srcrect
The blit function should not be called on a locked surface.
The results of blitting operations vary greatly depending on whether SDL_SRCAPLHA is set or not. See SDL_SetAlpha for an explaination of how this affects your results. Colorkeying and alpha attributes also interact with surface blitting, as the following pseudo-code should hopefully explain.
+
if (source surface has SDL_SRCALPHA set) {
+ if (source surface has alpha channel (that is, format->Amask != 0))
+ blit using per-pixel alpha, ignoring any colour key
+ else {
+ if (source surface has SDL_SRCCOLORKEY set)
+ blit using the colour key AND the per-surface alpha value
+ else
+ blit using the per-surface alpha value
+ }
+} else {
+ if (source surface has SDL_SRCCOLORKEY set)
+ blit using the colour key
+ else
+ ordinary opaque rectangular blit
+} Return Value If the blit is successful, it returns 0 ,
+otherwise it returns -1 .
If either of the surfaces were in video memory, and the blit returns
+-2 , the video memory was lost, so it should be
+reloaded with artwork and re-blitted:
+
while ( SDL_BlitSurface(image, imgrect, screen, dstrect) == -2 ) {
+ while ( SDL_LockSurface(image)) < 0 )
+ SDL_Delay(10);
+ -- Write image pixels to image->pixels --
+ SDL_UnlockSurface(image);
+ }
+This happens under DirectX 5.0 when the system switches away from your
+fullscreen application. Locking the surface will also fail until you
+have access to the video memory again.
SDL_BuildAudioCVT Name SDL_BuildAudioCVT -- Initializes a SDL_AudioCVT structure for conversion
Synopsis
#include "SDL.h" int SDL_BuildAudioCVT (SDL_AudioCVT *cvt, Uint16 src_format, Uint8 src_channels, int src_rate, Uint16 dst_format, Uint8 dst_channels, int dst_rate);
Description Before an SDL_AudioCVT
src_format dst_format SDL_AudioSpec src_channels dst_channels src_rate dst_rate SDL_AudioSpec
Return Values Returns -1 if the filter could not be built or 1 if it could.
SDL_CD Name SDL_CD -- CDROM Drive Information
Structure Definition typedef struct{
+ int id;
+ CDstatus status;
+ int numtracks;
+ int cur_track;
+ int cur_frame;
+ SDL_CDtrack track[SDL_MAX_TRACKS+1];
+} SDL_CD; Structure Data
id Private drive identifier status Drive status numtracks Number of tracks on the CD cur_track Current track cur_frame Current frame offset within the track track Array of track descriptions. (see SDL_CDtrack
Description An SDL_CD structure is returned by SDL_CDOpen
A frame is the base data unit of a CD. CD_FPS frames is equal to 1 second of music. SDL provides two macros for converting between time and frames: FRAMES_TO_MSF(f, M,S,F) and MSF_TO_FRAMES .
Examples int min, sec, frame;
+int frame_offset;
+
+FRAMES_TO_MSF(cdrom->cur_frame, &min, &sec, &frame);
+printf("Current Position: %d minutes, %d seconds, %d frames\n", min, sec, frame);
+
+frame_offset=MSF_TO_FRAMES(min, sec, frame); SDL_CDClose Name SDL_CDClose -- Closes a SDL_CD handle
Synopsis
#include "SDL.h" void SDL_CDClose (SDL_CD *cdrom);
Description Closes the given cdrom
SDL_CDEject Name SDL_CDEject -- Ejects a CDROM
Synopsis
#include "SDL.h" int SDL_CDEject (SDL_CD *cdrom);
Description Ejects the given cdrom
Return Value Returns 0 on success, or -1 on an error.
SDL_CDName Name SDL_CDName -- Returns a human-readable, system-dependent identifier for the CD-ROM.
Synopsis
#include "SDL.h" const char *SDL_CDName (int drive);
Description Returns a human-readable, system-dependent identifier for the CD-ROM. drive SDL_CDNumDrives() -1.
Examples
"/dev/cdrom"
"E:"
"/dev/disk/ide/1/master"
SDL_CDNumDrives Name SDL_CDNumDrives -- Returns the number of CD-ROM drives on the system.
Synopsis
#include "SDL.h" int SDL_CDNumDrives (void);
Description Returns the number of CD-ROM drives on the system.
SDL_CDOpen Name SDL_CDOpen -- Opens a CD-ROM drive for access.
Synopsis
#include "SDL.h" SDL_CD *SDL_CDOpen (int drive);
Description Opens a CD-ROM drive for access. It returns a SDL_CD NULL if the drive was invalid or busy. This newly opened CD-ROM becomes the default CD used when other CD functions are passed a NULL CD-ROM handle.
Drives are numbered starting with 0.
+Drive 0 is the system default CD-ROM.
Examples SDL_CD *cdrom;
+int cur_track;
+int min, sec, frame;
+SDL_Init(SDL_INIT_CDROM);
+atexit(SDL_Quit);
+
+/* Check for CD drives */
+if(!SDL_CDNumDrives()){
+ /* None found */
+ fprintf(stderr, "No CDROM devices available\n");
+ exit(-1);
+}
+
+/* Open the default drive */
+cdrom=SDL_CDOpen(0);
+
+/* Did if open? Check if cdrom is NULL */
+if(!cdrom){
+ fprintf(stderr, "Couldn't open drive: %s\n", SDL_GetError());
+ exit(-1);
+}
+
+/* Print Volume info */
+printf("Name: %s\n", SDL_CDName(0));
+printf("Tracks: %d\n", cdrom->numtracks);
+for(cur_track=0;cur_track < cdrom->numtracks; cur_track++){
+ FRAMES_TO_MSF(cdrom->track[cur_track].length, &min, &sec, &frame);
+ printf("\tTrack %d: Length %d:%d\n", cur_track, min, sec);
+}
+
+SDL_CDClose(cdrom); SDL_CDPause Name SDL_CDPause -- Pauses a CDROM
Synopsis
#include "SDL.h" int SDL_CDPause (SDL_CD *cdrom);
Description Pauses play on the given cdrom
Return Value Returns 0 on success, or -1 on an error.
SDL_CDPlay Name SDL_CDPlay -- Play a CD
Synopsis
#include "SDL.h" int SDL_CDPlay (SDL_CD *cdrom, int start, int length);
Description Plays the given cdrom start length
Return Values Returns 0 on success, or -1 on an error.
SDL_CDPlayTracks Name SDL_CDPlayTracks -- Play the given CD track(s)
Synopsis
#include "SDL.h" int SDL_CDPlayTracks (SDL_CD *cdrom, int start_track, int start_frame, int ntracks, int nframes));
Description SDL_CDPlayTracks plays the given CD starting at track
+start_track ntracks
start_frame start_track nframes start_track ntracks
SDL_CDPlayTracks should only be called after calling
+SDL_CDStatus
Note: Data tracks are ignored.
Return Value Returns 0 , or -1
+if there was an error.
Examples
/* assuming cdrom is a previously opened device */
+/* Play the entire CD */
+if(CD_INDRIVE(SDL_CDStatus(cdrom)))
+ SDL_CDPlayTracks(cdrom, 0, 0, 0, 0);
+
+/* Play the first track */
+if(CD_INDRIVE(SDL_CDStatus(cdrom)))
+ SDL_CDPlayTracks(cdrom, 0, 0, 1, 0);
+
+/* Play first 15 seconds of the 2nd track */
+if(CD_INDRIVE(SDL_CDStatus(cdrom)))
+ SDL_CDPlayTracks(cdrom, 1, 0, 0, CD_FPS*15);
+
SDL_CDResume Name SDL_CDResume -- Resumes a CDROM
Synopsis
#include "SDL.h" int SDL_CDResume (SDL_CD *cdrom);
Description Resumes play on the given cdrom
Return Value Returns 0 on success, or -1 on an error.
SDL_CDStatus Name SDL_CDStatus -- Returns the current status of the given drive.
Synopsis
#include "SDL.h" CDstatus SDL_CDStatus (SDL_CD *cdrom);
/* Given a status, returns true if there's a disk in the drive */
+#define CD_INDRIVE(status) ((int)status > 0)
Description This function returns the current status of the given drive. Status is described like so:
+
typedef enum {
+ CD_TRAYEMPTY,
+ CD_STOPPED,
+ CD_PLAYING,
+ CD_PAUSED,
+ CD_ERROR = -1
+} CDstatus; If the drive has a CD in it, the table of contents of the CD and current
+play position of the CD will be stored in the SDL_CD structure.
The macro CD_INDRIVE is provided for convenience,
+and given a status returns true if there's a disk in the drive.
Note: SDL_CDStatus also updates the SDL_CD
Example int playTrack(int track)
+{
+ int playing = 0;
+
+ if ( CD_INDRIVE(SDL_CDStatus(cdrom)) ) {
+ /* clamp to the actual number of tracks on the CD */
+ if (track >= cdrom->numtracks) {
+ track = cdrom->numtracks-1;
+ }
+
+ if ( SDL_CDPlayTracks(cdrom, track, 0, 1, 0) == 0 ) {
+ playing = 1;
+ }
+ }
+ return playing;
+} SDL_CDStop Name SDL_CDStop -- Stops a CDROM
Synopsis
#include "SDL.h" int SDL_CDStop (SDL_CD *cdrom);
Description Stops play on the given cdrom
Return Value Returns 0 on success, or -1 on an error.
SDL_CDtrack Name SDL_CDtrack -- CD Track Information Structure
Structure Definition typedef struct{
+ Uint8 id;
+ Uint8 type;
+ Uint32 length;
+ Uint32 offset;
+} SDL_CDtrack; Structure Data
id Track number (0-99) type SDL_AUDIO_TRACK or SDL_DATA_TRACK length Length, in frames, of this track offset Frame offset to the beginning of this track
Description SDL_CDtrack stores data on each track on a CD, its fields should be pretty self explainatory. It is a member a the SDL_CD
Note: Frames can be converted to standard timings. There are CD_FPS frames per second, so SDL_CDtrack .length CD_FPS =length_in_seconds.
SDL_CloseAudio Name SDL_CloseAudio -- Shuts down audio processing and closes the audio device.
Synopsis
#include "SDL.h" void SDL_CloseAudio (void);
Description This function shuts down audio processing and closes the audio device.
SDL_Color Name SDL_Color -- Format independent color description
Structure Definition typedef struct{
+ Uint8 r;
+ Uint8 g;
+ Uint8 b;
+ Uint8 unused;
+} SDL_Color; Structure Data
r Red intensity g Green intensity b Blue intensity unused Unused
Description SDL_Color describes a color in a format independent way. You can convert a SDL_Color to a pixel value for a certain pixel format using SDL_MapRGB
SDL_CondBroadcast Name SDL_CondBroadcast -- Restart all threads waiting on a condition variable
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" int SDL_CondBroadcast (SDL_cond *cond);
Description Restarts all threads that are waiting on the condition variable, cond 0 on success, or -1 on an error.
SDL_CondSignal Name SDL_CondSignal -- Restart a thread wait on a condition variable
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" int SDL_CondSignal (SDL_cond *cond);
Description Restart one of the threads that are waiting on the condition variable, cond 0 on success of -1 on an error.
SDL_CondWait Name SDL_CondWait -- Wait on a condition variable
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" int SDL_CondWait (SDL_cond *cond, SDL_mutex *mut);
Description Wait on the condition variable cond 0 when it is signalled, or -1 on an error.
SDL_CondWaitTimeout Name SDL_CondWaitTimeout -- Wait on a condition variable, with timeout
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" int SDL_CondWaitTimeout (SDL_cond *cond, SDL_mutex *mutex, Uint32 ms);
Description Wait on the condition variable cond ms mut SDL_MUTEX_TIMEDOUT if the condition is not signalled in the allotted time, 0 if it was signalled or -1 on an error.
SDL_ConvertAudio Name SDL_ConvertAudio -- Convert audio data to a desired audio format.
Synopsis
#include "SDL.h" int SDL_ConvertAudio (SDL_AudioCVT *cvt);
Description SDL_ConvertAudio takes one parameter, cvt SDL_AudioCVT SDL_BuildAudioCVT cvt ->buf cvt ->len cvt ->buf cvt ->len buf len len_mult
Once the SDL_AudioCVT structure is initilized then we can pass it to SDL_ConvertAudio , which will convert the audio data pointer to by cvt ->buf SDL_ConvertAudio returned 0 then the conversion was completed successfully, otherwise -1 is returned.
If the conversion completed successfully then the converted audio data can be read from cvt ->buf cvt ->len cvt len_ratio .
Examples /* Converting some WAV data to hardware format */
+void my_audio_callback(void *userdata, Uint8 *stream, int len);
+
+SDL_AudioSpec *desired, *obtained;
+SDL_AudioSpec wav_spec;
+SDL_AudioCVT wav_cvt;
+Uint32 wav_len;
+Uint8 *wav_buf;
+int ret;
+
+/* Allocated audio specs */
+desired = malloc(sizeof(SDL_AudioSpec));
+obtained = malloc(sizeof(SDL_AudioSpec));
+
+/* Set desired format */
+desired->freq=22050;
+desired->format=AUDIO_S16LSB;
+desired->samples=8192;
+desired->callback=my_audio_callback;
+desired->userdata=NULL;
+
+/* Open the audio device */
+if ( SDL_OpenAudio(desired, obtained) < 0 ){
+ fprintf(stderr, "Couldn't open audio: %s\n", SDL_GetError());
+ exit(-1);
+}
+
+free(desired);
+
+/* Load the test.wav */
+if( SDL_LoadWAV("test.wav", &wav_spec, &wav_buf, &wav_len) == NULL ){
+ fprintf(stderr, "Could not open test.wav: %s\n", SDL_GetError());
+ SDL_CloseAudio();
+ free(obtained);
+ exit(-1);
+}
+
+/* Build AudioCVT */
+ret = SDL_BuildAudioCVT(&wav_cvt,
+ wav_spec.format, wav_spec.channels, wav_spec.freq,
+ obtained->format, obtained->channels, obtained->freq);
+
+/* Check that the convert was built */
+if(ret==-1){
+ fprintf(stderr, "Couldn't build converter!\n");
+ SDL_CloseAudio();
+ free(obtained);
+ SDL_FreeWAV(wav_buf);
+}
+
+/* Setup for conversion */
+wav_cvt.buf = malloc(wav_len * wav_cvt.len_mult);
+wav_cvt.len = wav_len;
+memcpy(wav_cvt.buf, wav_buf, wav_len);
+
+/* We can delete to original WAV data now */
+SDL_FreeWAV(wav_buf);
+
+/* And now we're ready to convert */
+SDL_ConvertAudio(&wav_cvt);
+
+/* do whatever */
+.
+.
+.
+.
+
SDL_ConvertSurface Name SDL_ConvertSurface -- Converts a surface to the same format as another surface.
Synopsis
#include "SDL/SDL.h" SDL_Surface *SDL_ConvertSurface (SDL_Surface *src, SDL_PixelFormat *fmt, Uint32 flags);
Description Creates a new surface of the specified format, and then copies and maps
+the given surface to it. If this function fails, it returns
+NULL .
The flags SDL_CreateRGBSurface
This function is used internally by
+SDL_DisplayFormat
This function can only be called after SDL_Init.
Return Value Returns either a pointer to the new surface, or
+NULL on error.
SDL_CreateCond Name SDL_CreateCond -- Create a condition variable
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" SDL_cond *SDL_CreateCond (void);
Description Creates a condition variable.
Examples SDL_cond *cond;
+
+cond=SDL_CreateCond();
+.
+.
+/* Do stuff */
+
+.
+.
+SDL_DestroyCond(cond); SDL_CreateCursor Name SDL_CreateCursor -- Creates a new mouse cursor.
Synopsis
#include "SDL.h" SDL_Cursor *SDL_CreateCursor (Uint8 *data, Uint8 *mask, int w, int h, int hot_x, int hot_y);
Description Create a cursor using the specified data mask
The cursor is created in black and white according to the following:
+
Data / Mask Resulting pixel on screen 0 / 1 White 1 / 1 Black 0 / 0 Transparent 1 / 0 Inverted color if possible, black if not.
Cursors created with this function must be freed with
+SDL_FreeCursor .
Example /* Stolen from the mailing list */
+/* Creates a new mouse cursor from an XPM */
+
+
+/* XPM */
+static const char *arrow[] = {
+ /* width height num_colors chars_per_pixel */
+ " 32 32 3 1",
+ /* colors */
+ "X c #000000",
+ ". c #ffffff",
+ " c None",
+ /* pixels */
+ "X ",
+ "XX ",
+ "X.X ",
+ "X..X ",
+ "X...X ",
+ "X....X ",
+ "X.....X ",
+ "X......X ",
+ "X.......X ",
+ "X........X ",
+ "X.....XXXXX ",
+ "X..X..X ",
+ "X.X X..X ",
+ "XX X..X ",
+ "X X..X ",
+ " X..X ",
+ " X..X ",
+ " X..X ",
+ " XX ",
+ " ",
+ " ",
+ " ",
+ " ",
+ " ",
+ " ",
+ " ",
+ " ",
+ " ",
+ " ",
+ " ",
+ " ",
+ " ",
+ "0,0"
+};
+
+static SDL_Cursor *init_system_cursor(const char *image[])
+{
+ int i, row, col;
+ Uint8 data[4*32];
+ Uint8 mask[4*32];
+ int hot_x, hot_y;
+
+ i = -1;
+ for ( row=0; row<32; ++row ) {
+ for ( col=0; col<32; ++col ) {
+ if ( col % 8 ) {
+ data[i] <<= 1;
+ mask[i] <<= 1;
+ } else {
+ ++i;
+ data[i] = mask[i] = 0;
+ }
+ switch (image[4+row][col]) {
+ case 'X':
+ data[i] |= 0x01;
+ mask[i] |= 0x01;
+ break;
+ case '.':
+ mask[i] |= 0x01;
+ break;
+ case ' ':
+ break;
+ }
+ }
+ }
+ sscanf(image[4+row], "%d,%d", &hot_x, &hot_y);
+ return SDL_CreateCursor(data, mask, 32, 32, hot_x, hot_y);
+} SDL_CreateMutex Name SDL_CreateMutex -- Create a mutex
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" SDL_mutex *SDL_CreateMutex (void);
Description Create a new, unlocked mutex.
Examples SDL_mutex *mut;
+
+mut=SDL_CreateMutex();
+.
+.
+if(SDL_mutexP(mut)==-1){
+ fprintf(stderr, "Couldn't lock mutex\n");
+ exit(-1);
+}
+.
+/* Do stuff while mutex is locked */
+.
+.
+if(SDL_mutexV(mut)==-1){
+ fprintf(stderr, "Couldn't unlock mutex\n");
+ exit(-1);
+}
+
+SDL_DestroyMutex(mut);
SDL_CreateRGBSurface Name SDL_CreateRGBSurface -- Create an empty SDL_Surface
Synopsis
#include "SDL.h" SDL_Surface *SDL_CreateRGBSurface (Uint32 flags, int width, int height, int depth, Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask);
Description Allocate an empty surface (must be called after SDL_SetVideoMode )
If depth SDL_PixelFormat [RGBA]mask SDL_PixelFormat flags
SDL_SWSURFACE SDL will create the surface in system memory. This improves the performance of pixel level access, however you may not be able to take advantage of some types of hardware blitting. SDL_HWSURFACE SDL will attempt to create the surface in video memory. This will allow SDL to take advantage of Video->Video blits (which are often accelerated). SDL_SRCCOLORKEY This flag turns on colourkeying for blits from this surface. If
+SDL_HWSURFACE is also specified and colourkeyed blits
+are hardware-accelerated, then SDL will attempt to place the surface in
+video memory.
+Use SDL_SetColorKey SDL_SRCALPHA This flag turns on alpha-blending for blits from this surface. If
+SDL_HWSURFACE is also specified and alpha-blending blits
+are hardware-accelerated, then the surface will be placed in video memory if
+possible.
+Use SDL_SetAlpha
Note: If an alpha-channel is specified (that is, if Amask SDL_SRCALPHA flag is automatically
+set. You may remove this flag by calling
+SDL_SetAlpha
Return Value Returns the created surface, or NULL upon error.
Example /* Create a 32-bit surface with the bytes of each pixel in R,G,B,A order,
+ as expected by OpenGL for textures */
+ SDL_Surface *surface;
+ Uint32 rmask, gmask, bmask, amask;
+
+ /* SDL interprets each pixel as a 32-bit number, so our masks must depend
+ on the endianness (byte order) of the machine */
+#if SDL_BYTEORDER == SDL_BIG_ENDIAN
+ rmask = 0xff000000;
+ gmask = 0x00ff0000;
+ bmask = 0x0000ff00;
+ amask = 0x000000ff;
+#else
+ rmask = 0x000000ff;
+ gmask = 0x0000ff00;
+ bmask = 0x00ff0000;
+ amask = 0xff000000;
+#endif
+
+ surface = SDL_CreateRGBSurface(SDL_SWSURFACE, width, height, 32,
+ rmask, gmask, bmask, amask);
+ if(surface == NULL) {
+ fprintf(stderr, "CreateRGBSurface failed: %s\n", SDL_GetError());
+ exit(1);
+ } SDL_CreateRGBSurfaceFrom Name SDL_CreateRGBSurfaceFrom -- Create an SDL_Surface from pixel data
Synopsis
#include "SDL.h" SDL_Surface *SDL_CreateRGBSurfaceFrom (void *pixels, int width, int height, int depth, int pitch, Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask);
Description Creates an SDL_Surface from the provided pixel data.
The data stored in pixels depth SDL_Surface structure so it should not be freed until the surface has been freed with a called to SDL_FreeSurface . pitch
See SDL_CreateRGBSurface
Return Value Returns the created surface, or NULL upon error.
SDL_CreateSemaphore Name SDL_CreateSemaphore -- Creates a new semaphore and assigns an initial value to it.
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" SDL_sem *SDL_CreateSemaphore (Uint32 initial_value);
Description SDL_CreateSemaphore() creates a new semaphore and
+initializes it with the value initial_value SDL_SemWait ,
+SDL_SemTryWait or
+SDL_SemWaitTimeout
+will atomically decrement the semaphore value. The locking operation will be blocked
+if the semaphore value is not positive (greater than zero). Each unlock operation by
+SDL_SemPost
+will atomically increment the semaphore value.
Return Value Returns a pointer to an initialized semaphore or
+NULL if there was an error.
Examples
SDL_sem *my_sem;
+
+my_sem = SDL_CreateSemaphore(INITIAL_SEM_VALUE);
+
+if (my_sem == NULL) {
+ return CREATE_SEM_FAILED;
+} SDL_CreateThread Name SDL_CreateThread -- Creates a new thread of execution that shares its parent's properties.
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" SDL_Thread *SDL_CreateThread (int (*fn)(void *), void *data);
Description SDL_CreateThread creates a new thread of execution
+that shares all of its parent's global memory, signal handlers,
+file descriptors, etc, and runs the function fn data
SDL_CreateYUVOverlay Name SDL_CreateYUVOverlay -- Create a YUV video overlay
Synopsis
#include "SDL.h" SDL_Overlay *SDL_CreateYUVOverlay (int width, int height, Uint32 format, SDL_Surface *display);
Description SDL_CreateYUVOverlay creates a YUV overlay of the specified width height format SDL_Overlay display SDL_Overlay
The term 'overlay' is a misnomer since, unless the overlay is created in hardware, the contents for the display surface underneath the area where the overlay is shown will be overwritten when the overlay is displayed.
SDL_Delay Name SDL_Delay -- Wait a specified number of milliseconds before returning.
Synopsis
#include "SDL.h" void SDL_Delay (Uint32 ms);
Description Wait a specified number of milliseconds before returning. SDL_Delay will wait at least
Note: Count on a delay granularity of at least
SDL_DestroyCond Name SDL_DestroyCond -- Destroy a condition variable
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" void SDL_DestroyCond (SDL_cond *cond);
Description Destroys a condition variable.
SDL_DestroyMutex Name SDL_DestroyMutex -- Destroy a mutex
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" void SDL_DestroyMutex (SDL_mutex *mutex);
Description Destroy a previously created mutex.
SDL_DestroySemaphore Synopsis
#include "SDL.h"
+#include "SDL_thread.h" void SDL_DestroySemaphore (SDL_sem *sem);
Description SDL_DestroySemaphore destroys the semaphore pointed to
+by sem SDL_CreateSemaphore
Examples
if (my_sem != NULL) {
+ SDL_DestroySemaphore(my_sem);
+ my_sem = NULL;
+} SDL_DisplayFormat Name SDL_DisplayFormat -- Convert a surface to the display format
Synopsis
#include "SDL.h" SDL_Surface *SDL_DisplayFormat (SDL_Surface *surface);
Description This function takes a surface and copies it to a new surface of the
+pixel format and colors of the video framebuffer, suitable for fast
+blitting onto the display surface. It calls
+SDL_ConvertSurface
If you want to take advantage of hardware colorkey or alpha blit
+acceleration, you should set the colorkey and alpha value before
+calling this function.
If you want an alpha channel, see SDL_DisplayFormatAlpha .
Return Value If the conversion fails or runs out of memory, it returns
+NULL
SDL_DisplayFormatAlpha Name SDL_DisplayFormatAlpha -- Convert a surface to the display format
Synopsis
#include "SDL.h" SDL_Surface *SDL_DisplayFormatAlpha (SDL_Surface *surface);
Description This function takes a surface and copies it to a new surface of the
+pixel format and colors of the video framebuffer plus an alpha channel,
+suitable for fast blitting onto the display surface. It calls
+SDL_ConvertSurface
If you want to take advantage of hardware colorkey or alpha blit
+acceleration, you should set the colorkey and alpha value before
+calling this function.
This function can be used to convert a colourkey to an alpha channel,
+if the SDL_SRCCOLORKEY flag is set on the surface.
+The generated surface will then be transparent (alpha=0) where the
+pixels match the colourkey, and opaque (alpha=255) elsewhere.
Return Value If the conversion fails or runs out of memory, it returns
+NULL
SDL_DisplayYUVOverlay Name SDL_DisplayYUVOverlay -- Blit the overlay to the display
Synopsis
#include "SDL.h" int SDL_DisplayYUVOverlay (SDL_Overlay *overlay, SDL_Rect *dstrect);
Description Blit the overlay created . The SDL_Rect dstrect dstrect
Return Values Returns 0 on success
SDL_EnableKeyRepeat Name SDL_EnableKeyRepeat -- Set keyboard repeat rate.
Synopsis
#include "SDL.h" int SDL_EnableKeyRepeat (int delay, int interval);
Description Enables or disables the keyboard repeat rate. delay interval delay interval
Setting delay SDL_DEFAULT_REPEAT_DELAY and SDL_DEFAULT_REPEAT_INTERVAL .
Return Value Returns 0 on success and -1 on failure.
SDL_EnableUNICODE Name SDL_EnableUNICODE -- Enable UNICODE translation
Synopsis
#include "SDL.h" int SDL_EnableUNICODE (int enable);
Description Enables/Disables Unicode keyboard translation.
To obtain the character codes corresponding to received keyboard events,
+Unicode translation must first be turned on using this function. The
+translation incurs a slight overhead for each keyboard event and is therefore
+disabled by default. For each subsequently received key down event, the
+unicode SDL_keysym
A value of 1 for enable
Note that only key press events will be translated, not release events.
Return Value Returns the previous translation mode (0 or 1 ).
SDL_envvars Name SDL_envvars -- SDL environment variables
Description Not a function, set using setenv()
Several environment variables are available to modify the
+behaviour of SDL. Using these variables isn't recommened and the names
+and presence of these variables aren't guaranteed from one release to
+the next. However, they can be very useful for debugging
+purposes.
Video
SDL_FBACCEL If set to 0, disable hardware acceleration in the linux fbcon driver.
SDL_FBDEV Frame buffer device to use in the linux fbcon driver, instead of /dev/fb0
SDL_FULLSCREEN_UPDATE In the ps2gs driver, sets the SDL_ASYNCBLIT flag on the
+display surface.
SDL_VIDEODRIVER Selectes the video driver for SDL to use. Possible values, in the
+order they are tried if this variable is not set:
x11
dga (the XFree86 DGA2)
nanox (Linux)
fbcon (Linux)
directfb (Linux)
ps2gs (Playstation 2)
ggi
vgl (BSD)
svgalib (Linux)
aalib
directx (Win32)
windib (Win32)
bwindow (BeOS)
toolbox (MacOS Classic)
DSp (MacOS Classic)
Quartz (Mac OS X)
CGX (Amiga)
photon (QNX)
dummy
SDL_VIDEO_CENTERED If set, tries to center the SDL window when running in X11 windowed
+mode, or using the CyberGrafix driver.
SDL_VIDEO_GL_DRIVER The openGL driver (shared library) to use for X11. Default is libGL.so.1
SDL_VIDEO_X11_DGAMOUSE With XFree86, enables use of DGA mouse if set.
SDL_VIDEO_X11_MOUSEACCEL For X11, sets the mouse acceleration. The value should be a string
+on the form:
"n d t
where n d n d t
SDL_VIDEO_X11_NODIRECTCOLOR If set, don't attempt to use DirectColor visuals even if they are
+present. (SDL will use them otherwise for gamma correction).
+This is needed with older X servers when using the XVideo extension.
SDL_VIDEO_X11_VISUALID ID of an X11 visual to use, overriding SDL's default visual selection
+algorithm. It can be in decimal or in hex (prefixed by 0x).
SDL_VIDEO_YUV_DIRECT If set, display YUV overlay directly on the video surface if possible,
+instead of on the surface passed to
+SDL_CreateYUVOverlay
SDL_VIDEO_YUV_HWACCEL If not set or set to a nonzero value, SDL will attempt to use
+hardware YUV acceleration for video playback.
SDL_WINDOWID For X11 or Win32, contains the ID number of the window to be used by
+SDL instead of creating its own window. Either in decimal or
+in hex (prefixed by 0x).
Events/Input
SDL_MOUSE_RELATIVE If set to 0, do not use mouse relative mode in X11. The default is
+to use it if the mouse is hidden and input is grabbed.
SDL_MOUSEDEV The mouse device to use for the linux fbcon driver. If not set,
+SDL first tries to use GPM in repeater mode, then various other
+devices (/dev/pcaux, /dev/adbmouse, /dev/mouse etc).
SDL_MOUSEDEV_IMPS2 If set, SDL will not try to auto-detect the IMPS/2 protocol of
+a PS/2 mouse but use it right away. For the fbcon and ps2gs drivers.
SDL_MOUSEDRV For the linux fbcon driver: if set to ELO, use the ELO touchscreen
+controller as a pointer device
SDL_NO_RAWKBD For the libvga driver: If set, do not attempt to put the keyboard in raw mode.
SDL_NOMOUSE If set, the linux fbcon driver will not use a mouse at all.
SDL_NO_LOCK_KEYS Disable CAPS-LOCK and NUM-LOCK suppression of down+up key events,
+suitable for games where the player needs these keys to do more than just toggle.
+A value of 1 will effect both CAPS-LOCK and NUM-LOCK.
+A value of 2 will effect only CAPS-LOCK.
+A value of 3 will effect only NUM-LOCK.
+All other values have no effect.
+
Audio
AUDIODEV The audio device to use, if SDL_PATH_DSP isn't set.
SDL_AUDIODRIVER Selects the audio driver for SDL to use. Possible values, in the
+order they are tried if this variable is not set:
openbsd (OpenBSD)
dsp (OSS /dev/dsp: Linux, Solaris, BSD etc)
alsa (Linux)
pulse (PulseAudio daemon)
audio (Unix style /dev/audio: SunOS, Solaris etc)
AL (Irix)
artsc (ARTS audio daemon)
esd (esound audio daemon)
nas (NAS audio daemon)
dma (OSS /dev/dsp, using DMA)
dsound (Win32 DirectX)
waveout (Win32 WaveOut)
baudio (BeOS)
sndmgr (MacOS SoundManager)
paud (AIX)
AHI (Amiga)
disk (all; output to file)
SDL_DISKAUDIOFILE The name of the output file for the "disk" audio driver. If not
+set, the name sdlaudio.raw is used.
SDL_DISKAUDIODELAY For the "disk" audio driver, how long to wait (in ms) before writing
+a full sound buffer. The default is 150 ms.
SDL_DSP_NOSELECT For some audio drivers (alsa, paud, dma and dsp), don't use select()
+but a timed method instead. May cure some audio problems, or cause
+others.
SDL_PATH_DSP The audio device to use. If not set, SDL tries AUDIODEV and then
+a platform-dependent default value (/dev/audio on Solaris,
+/dev/dsp on Linux etc).
CD-ROM
SDL_CDROM A colon-separated list of CD-ROM devices to use, in addition to
+the standard devices (typically /dev/cdrom, platform-dependent).
Debugging
SDL_DEBUG If set, causes every call to SDL_SetError (that
+is, every time SDL signals an error) to also print an error message on
+stderr.
Joystick
SDL_JOYSTICK_DEVICE Joystick device to use in the linux joystick driver, in addition
+to the usual: /dev/js*, /dev/input/event*, /dev/input/js*
SDL_LINUX_JOYSTICK Special joystick configuration string for linux. The format is
"name numaxes numhats numballs
where name
SDL_Event Name SDL_Event -- General event structure
Structure Definition typedef union{
+ Uint8 type;
+ SDL_ActiveEvent active;
+ SDL_KeyboardEvent key;
+ SDL_MouseMotionEvent motion;
+ SDL_MouseButtonEvent button;
+ SDL_JoyAxisEvent jaxis;
+ SDL_JoyBallEvent jball;
+ SDL_JoyHatEvent jhat;
+ SDL_JoyButtonEvent jbutton;
+ SDL_ResizeEvent resize;
+ SDL_ExposeEvent expose;
+ SDL_QuitEvent quit;
+ SDL_UserEvent user;
+ SDL_SysWMEvent syswm;
+} SDL_Event; Description The SDL_Event union is the core to all event handling is SDL, its probably the most important structure after SDL_Surface . SDL_Event is a union of all event structures used in SDL, using it is a simple matter of knowing which union member relates to which event type
Use The SDL_Event structure has two uses
Reading events from the event queue is done with either SDL_PollEvent SDL_PeepEvents SDL_PollEvent and step through an example.
First off, we create an empty SDL_Event structure.
+
SDL_Event test_event;
+
SDL_PollEvent removes the next event from the event queue, if there are no events on the queue it returns
0 otherwise it returns
1 . We use a
while loop to process each event in turn.
+
while(SDL_PollEvent(&test_event)) {
+The
SDL_PollEvent function take a pointer to an
SDL_Event structure that is to be filled with event information. We know that if
SDL_PollEvent removes an event from the queue then the event information will be placed in our
test_event structure, but we also know that the
type of event will be placed in the
type member of
test_event . So to handle each event
type seperately we use a
switch statement.
+
switch(test_event.type) {
+We need to know what kind of events we're looking for
and the event
type 's of those events. So lets assume we want to detect where the user is moving the mouse pointer within our application. We look through our event types and notice that
SDL_MOUSEMOTION is, more than likely, the event we're looking for. A little
more research tells use that
SDL_MOUSEMOTION events are handled within the
SDL_MouseMotionEvent structure which is the
motion member of
SDL_Event . We can check for the
SDL_MOUSEMOTION event
type within our
switch statement like so:
+
case SDL_MOUSEMOTION:
+All we need do now is read the information out of the
motion member of
test_event .
+
printf("We got a motion event.\n");
+ printf("Current mouse position is: (%d, %d)\n", test_event.motion.x, test_event.motion.y);
+ break;
+ default:
+ printf("Unhandled Event!\n");
+ break;
+ }
+}
+printf("Event queue empty.\n"); It is also possible to push events onto the event queue and so use it as a two-way communication path. Both SDL_PushEvent SDL_PeepEvents SDL_USEREVENT on the event queue, however you could use it to post fake input events if you wished. Creating your own events is a simple matter of choosing the event type you want, setting the type
SDL_Event user_event;
+
+user_event.type=SDL_USEREVENT;
+user_event.user.code=2;
+user_event.user.data1=NULL;
+user_event.user.data2=NULL;
+SDL_PushEvent(&user_event); SDL_EventState Name SDL_EventState -- This function allows you to set the state of processing certain events.
Synopsis
#include "SDL.h" Uint8 SDL_EventState (Uint8 type, int state);
Description This function allows you to set the state of processing certain event type
If state SDL_IGNORE ,
+that event type
If state SDL_ENABLE ,
+that event type
If state SDL_QUERY ,
+SDL_EventState will return the current processing
+state of the specified event type
A list of event type SDL_Event
SDL_ExposeEvent Name SDL_ExposeEvent -- Quit requested event
Structure Definition typedef struct{
+ Uint8 type
+} SDL_ExposeEvent; Description SDL_ExposeEvent is a member of the SDL_Event SDL_VIDEOEXPOSE is reported.
A VIDEOEXPOSE event is triggered when the screen has been modified
+outside of the application, usually by the window manager and needs to
+be redrawn.
SDL_FillRect Name SDL_FillRect -- This function performs a fast fill of the given rectangle with some color
Synopsis
#include "SDL.h" int SDL_FillRect (SDL_Surface *dst, SDL_Rect *dstrect, Uint32 color);
Description This function performs a fast fill of the given rectangle with
+color dstrect NULL , the whole surface will be filled with
+color
The color should be a pixel of the format used by the surface, and
+can be generated by the
+SDL_MapRGB or SDL_MapRGBA
+functions. If the color value contains an alpha value then the
+destination is simply "filled" with that alpha information, no blending
+takes place.
If there is a clip rectangle set on the destination (set via
+SDL_SetClipRect ) then this
+function will clip based on the intersection of the clip rectangle and
+the dstrect
Return Value This function returns 0 on success, or
+-1 on error.
SDL_Flip Name SDL_Flip -- Swaps screen buffers
Synopsis
#include "SDL.h" int SDL_Flip (SDL_Surface *screen);
Description On hardware that supports double-buffering, this function sets up a flip
+and returns. The hardware will wait for vertical retrace, and then swap
+video buffers before the next video surface blit or lock will return.
+On hardware that doesn't support double-buffering, this is equivalent
+to calling SDL_UpdateRect (screen, 0, 0, 0, 0)
The SDL_DOUBLEBUF flag must have been passed to
+SDL_SetVideoMode ,
+ when
+setting the video mode for this function to perform hardware flipping.
Return Value This function returns 0 if successful, or
+-1 if there was an error.
SDL_FreeCursor Name SDL_FreeCursor -- Frees a cursor created with SDL_CreateCursor.
Synopsis
#include "SDL.h" void SDL_FreeCursor (SDL_Cursor *cursor);
SDL_FreeSurface Name SDL_FreeSurface -- Frees (deletes) a SDL_Surface
Synopsis
#include "SDL.h" void SDL_FreeSurface (SDL_Surface *surface);
Description Frees the resources used by a previously created SDL_Surface . If the surface was created using
+SDL_CreateRGBSurfaceFrom then the pixel data is not freed.
SDL_FreeWAV Name SDL_FreeWAV -- Frees previously opened WAV data
Synopsis
#include "SDL.h" void SDL_FreeWAV (Uint8 *audio_buf);
Description After a WAVE file has been opened with SDL_LoadWAV SDL_FreeWAV . audio_buf SDL_LoadWAV .
SDL_FreeYUVOverlay Name SDL_FreeYUVOverlay -- Free a YUV video overlay
Synopsis
#include "SDL.h" void SDL_FreeYUVOverlay (SDL_Overlay *overlay);
SDL_GetAppState Name SDL_GetAppState -- Get the state of the application
Synopsis
#include "SDL.h" Uint8 SDL_GetAppState (void);
Description This function returns the current state of the application. The value returned is a bitwise combination of:
SDL_APPMOUSEFOCUS The application has mouse focus. SDL_APPINPUTFOCUS The application has keyboard focus SDL_APPACTIVE The application is visible
SDL_GetAudioStatus Name SDL_GetAudioStatus -- Get the current audio state
Synopsis
#include "SDL.h" SDL_audiostatusSDL_GetAudioStatus (void);
Description typedef enum{
+ SDL_AUDIO_STOPPED,
+ SDL_AUDIO_PAUSED,
+ SDL_AUDIO_PLAYING
+} SDL_audiostatus; Returns either SDL_AUDIO_STOPPED , SDL_AUDIO_PAUSED or SDL_AUDIO_PLAYING depending on the current audio state.
SDL_GetClipRect Name SDL_GetClipRect -- Gets the clipping rectangle for a surface.
Synopsis
#include "SDL.h" void SDL_GetClipRect (SDL_Surface *surface, SDL_Rect *rect);
Description Gets the clipping rectangle for a surface. When this surface is the
+destination of a blit, only the area within the clip rectangle is
+drawn into.
The rectangle pointed to by rect
SDL_GetCursor Name SDL_GetCursor -- Get the currently active mouse cursor.
Synopsis
#include "SDL.h" SDL_Cursor *SDL_GetCursor (void);
Description Returns the currently active mouse cursor.
SDL_GetError Name SDL_GetError -- Get SDL error string
Synopsis
#include "SDL/SDL.h" char *SDL_GetError (void);
Description SDL_GetError returns a NULL terminated string containing information about the last internal SDL error.
Return Value SDL_GetError returns a string containing the last error.
SDL_GetEventFilter Name SDL_GetEventFilter -- Retrieves a pointer to he event filter
Synopsis
#include "SDL.h" SDL_EventFilter SDL_GetEventFilter (void);
Description This function retrieces a pointer to the event filter that was previously set using SDL_SetEventFilter
typedef int (*SDL_EventFilter)(const SDL_Event *event); Return Value Returns a pointer to the event filter or NULL if no filter has been set.
SDL_GetGammaRamp Name SDL_GetGammaRamp -- Gets the color gamma lookup tables for the display
Synopsis
#include "SDL.h" int SDL_GetGammaRamp (Uint16 *redtable, Uint16 *greentable, Uint16 *bluetable);
Description Gets the gamma translation lookup tables currently used by the display.
+Each table is an array of 256 Uint16 values.
Not all display hardware is able to change gamma.
Return Value Returns -1 on error.
SDL_GetKeyName Name SDL_GetKeyName -- Get the name of an SDL virtual keysym
Synopsis
#include "SDL.h" char *SDL_GetKeyName (SDLKey key);
Description Returns the SDL-defined name of the SDLKey key
SDL_GetKeyState Name SDL_GetKeyState -- Get a snapshot of the current keyboard state
Synopsis
#include "SDL.h" Uint8 *SDL_GetKeyState (int *numkeys);
Description Gets a snapshot of the current keyboard state. The current state is return as a pointer to an array, the size of this array is stored in numkeys SDLK_*
Example
Uint8 *keystate = SDL_GetKeyState(NULL);
+if ( keystate[SDLK_RETURN] ) printf("Return Key Pressed.\n"); SDL_GetModState Name SDL_GetModState -- Get the state of modifier keys.
Synopsis
#include "SDL.h" SDLMod SDL_GetModState (void);
Description Returns the current state of the modifier keys (CTRL, ALT, etc.).
Return Value The return value can be an OR'd combination of the SDLMod enum.
SDLMod
typedef enum {
+ KMOD_NONE = 0x0000,
+ KMOD_LSHIFT= 0x0001,
+ KMOD_RSHIFT= 0x0002,
+ KMOD_LCTRL = 0x0040,
+ KMOD_RCTRL = 0x0080,
+ KMOD_LALT = 0x0100,
+ KMOD_RALT = 0x0200,
+ KMOD_LMETA = 0x0400,
+ KMOD_RMETA = 0x0800,
+ KMOD_NUM = 0x1000,
+ KMOD_CAPS = 0x2000,
+ KMOD_MODE = 0x4000,
+} SDLMod;
+SDL also defines the following symbols for convenience:
+
#define KMOD_CTRL (KMOD_LCTRL|KMOD_RCTRL)
+#define KMOD_SHIFT (KMOD_LSHIFT|KMOD_RSHIFT)
+#define KMOD_ALT (KMOD_LALT|KMOD_RALT)
+#define KMOD_META (KMOD_LMETA|KMOD_RMETA) SDL_GetMouseState Name SDL_GetMouseState -- Retrieve the current state of the mouse
Synopsis
#include "SDL.h" Uint8 SDL_GetMouseState (int *x, int *y);
Description The current button state is returned as a button bitmask, which can
+be tested using the SDL_BUTTON(X) macros, and x y NULL for either x y
Example SDL_PumpEvents();
+if(SDL_GetMouseState(NULL, NULL)&SDL_BUTTON(1))
+ printf("Mouse Button 1(left) is pressed.\n"); SDL_GetRelativeMouseState Name SDL_GetRelativeMouseState -- Retrieve the current state of the mouse
Synopsis
#include "SDL.h" Uint8 SDL_GetRelativeMouseState (int *x, int *y);
Description The current button state is returned as a button bitmask, which can
+be tested using the SDL_BUTTON(X) macros, and x y SDL_GetRelativeMouseState or since event initialization. You can pass NULL for either x y
SDL_GetRGB Name SDL_GetRGB -- Get RGB values from a pixel in the specified pixel format.
Synopsis
#include "SDL.h" void SDL_GetRGB (Uint32 pixel, SDL_PixelFormat *fmt, Uint8 *r, Uint8 *g, Uint8 *b);
Description Get RGB component values from a pixel stored in the specified pixel format.
This function uses the entire 8-bit [0..255] range when converting color
+components from pixel formats with less than 8-bits per RGB component
+(e.g., a completely white pixel in 16-bit RGB565 format would return
+[0xff, 0xff, 0xff] not [0xf8, 0xfc, 0xf8]).
SDL_GetRGBA Name SDL_GetRGBA -- Get RGBA values from a pixel in the specified pixel format.
Synopsis
#include "SDL.h" void SDL_GetRGBA (Uint32 pixel, SDL_PixelFormat *fmt, Uint8 *r, Uint8 *g, Uint8 *b, Uint8 *a);
Description Get RGBA component values from a pixel stored in the specified pixel format.
This function uses the entire 8-bit [0..255] range when converting color
+components from pixel formats with less than 8-bits per RGB component
+(e.g., a completely white pixel in 16-bit RGB565 format would return
+[0xff, 0xff, 0xff] not [0xf8, 0xfc, 0xf8]).
If the surface has no alpha component, the alpha will be returned as 0xff
+(100% opaque).
SDL_GetThreadID Name SDL_GetThreadID -- Get the SDL thread ID of a SDL_Thread
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" Uint32 SDL_GetThreadID (SDL_Thread *thread);
SDL_GetTicks Name SDL_GetTicks -- Get the number of milliseconds since the SDL library initialization.
Synopsis
#include "SDL.h" Uint32 SDL_GetTicks (void);
Description Get the number of milliseconds since the SDL library initialization.
+Note that this value wraps if the program runs for more than ~49 days.
SDL_GetVideoInfo Name SDL_GetVideoInfo -- returns a pointer to information about the video hardware
Synopsis
#include "SDL.h" SDL_VideoInfo *SDL_GetVideoInfo (void);
Description This function returns a read-only pointer to information about the video
+hardware. If this is called before SDL_SetVideoMode , the
+vfmt
SDL_GetVideoSurface Name SDL_GetVideoSurface -- returns a pointer to the current display surface
Synopsis
#include "SDL.h" SDL_Surface *SDL_GetVideoSurface (void);
Description This function returns a pointer to the current display surface.
+If SDL is doing format conversion on the display surface, this
+function returns the publicly visible surface, not the real video
+surface.
SDL_GLattr Name SDL_GLattr -- SDL GL Attributes
Attributes
SDL_GL_RED_SIZE Size of the framebuffer red component, in bits SDL_GL_GREEN_SIZE Size of the framebuffer green component, in bits SDL_GL_BLUE_SIZE Size of the framebuffer blue component, in bits SDL_GL_ALPHA_SIZE Size of the framebuffer alpha component, in bits SDL_GL_DOUBLEBUFFER 0 or 1, enable or disable double buffering SDL_GL_BUFFER_SIZE Size of the framebuffer, in bits SDL_GL_DEPTH_SIZE Size of the depth buffer, in bits SDL_GL_STENCIL_SIZE Size of the stencil buffer, in bits SDL_GL_ACCUM_RED_SIZE Size of the accumulation buffer red component, in bits SDL_GL_ACCUM_GREEN_SIZE Size of the accumulation buffer green component, in bits SDL_GL_ACCUM_BLUE_SIZE Size of the accumulation buffer blue component, in bits SDL_GL_ACCUM_ALPHA_SIZE Size of the accumulation buffer alpha component, in bits
Description While you can set most OpenGL attributes normally, the attributes list above must be known before SDL_GL_SetAttribute SDL_GL_GetAttribute
SDL_GL_GetAttribute Name SDL_GL_GetAttribute -- Get the value of a special SDL/OpenGL attribute
Synopsis
#include "SDL.h" int SDL_GL_GetAttribute (SDLGLattr attr, int *value);
Description Places the value of the SDL/OpenGL attribute attr value SDL_SetVideoMode set as you expected.
Return Value Returns 0 on success, or -1 on an error.
SDL_GL_GetProcAddress Name SDL_GL_GetProcAddress -- Get the address of a GL function
Synopsis
#include "SDL.h" void *SDL_GL_GetProcAddress (const char* proc);
Description Returns the address of the GL function proc NULL if the function is not found. If the GL library is loaded at runtime, with SDL_GL_LoadLibrary all
Example typedef void (*GL_ActiveTextureARB_Func)(unsigned int);
+GL_ActiveTextureARB_Func glActiveTextureARB_ptr = 0;
+int has_multitexture=1;
+.
+.
+.
+/* Get function pointer */
+glActiveTextureARB_ptr=(GL_ActiveTextureARB_Func) SDL_GL_GetProcAddress("glActiveTextureARB");
+
+/* Check for a valid function ptr */
+if(!glActiveTextureARB_ptr){
+ fprintf(stderr, "Multitexture Extensions not present.\n");
+ has_multitexture=0;
+}
+.
+.
+.
+.
+if(has_multitexture){
+ glActiveTextureARB_ptr(GL_TEXTURE0_ARB);
+ .
+ .
+}
+else{
+ .
+ .
+} SDL_GL_LoadLibrary Name SDL_GL_LoadLibrary -- Specify an OpenGL library
Synopsis
#include "SDL.h" int SDL_GL_LoadLibrary (const char *path);
Description If you wish, you may load the OpenGL library at runtime, this must be done before SDL_SetVideoMode path SDL_GL_LoadLibrary and it returns 0 on success, or -1 on an error. You must then use SDL_GL_GetProcAddress
SDL_GL_SetAttribute Name SDL_GL_SetAttribute -- Set a special SDL/OpenGL attribute
Synopsis
#include "SDL.h" int SDL_GL_SetAttribute (SDL_GLattr attr, int value);
Return Value Returns 0 on success, or -1 on error.
Example SDL_GL_SetAttribute( SDL_GL_RED_SIZE, 5 );
+SDL_GL_SetAttribute( SDL_GL_GREEN_SIZE, 5 );
+SDL_GL_SetAttribute( SDL_GL_BLUE_SIZE, 5 );
+SDL_GL_SetAttribute( SDL_GL_DEPTH_SIZE, 16 );
+SDL_GL_SetAttribute( SDL_GL_DOUBLEBUFFER, 1 );
+if ( (screen=SDL_SetVideoMode( 640, 480, 16, SDL_OPENGL )) == NULL ) {
+ fprintf(stderr, "Couldn't set GL mode: %s\n", SDL_GetError());
+ SDL_Quit();
+ return;
+} Note: The SDL_DOUBLEBUF flag is not required to enable double buffering when setting an OpenGL video mode. Double buffering is enabled or disabled using the SDL_GL_DOUBLEBUFFER attribute.
SDL_GL_SwapBuffers Name SDL_GL_SwapBuffers -- Swap OpenGL framebuffers/Update Display
Synopsis
#include "SDL.h" void SDL_GL_SwapBuffers (void );
Description Swap the OpenGL buffers, if double-buffering is supported.
SDL_Init Name SDL_Init -- Initializes SDL
Synopsis
#include "SDL.h" int SDL_Init (Uint32 flags);
Description Initializes SDL. This should be called before all other SDL functions. The flags
SDL_INIT_TIMER Initializes the timer subsystem. SDL_INIT_AUDIO Initializes the audio subsystem. SDL_INIT_VIDEO Initializes the video subsystem. SDL_INIT_CDROM Initializes the cdrom subsystem. SDL_INIT_JOYSTICK Initializes the joystick subsystem. SDL_INIT_EVERYTHING Initialize all of the above. SDL_INIT_NOPARACHUTE Prevents SDL from catching fatal signals. SDL_INIT_EVENTTHREAD
Return Value Returns -1 on an error or 0 on success.
SDL_InitSubSystem Name SDL_InitSubSystem -- Initialize subsystems
Synopsis
#include "SDL.h" int SDL_InitSubSystem (Uint32 flags);
Description After SDL has been initialized with SDL_Init SDL_InitSubSystem . The flags SDL_Init
Examples /* Seperating Joystick and Video initialization. */
+SDL_Init(SDL_INIT_VIDEO);
+.
+.
+SDL_SetVideoMode(640, 480, 16, SDL_DOUBLEBUF|SDL_FULLSCREEN);
+.
+/* Do Some Video stuff */
+.
+.
+/* Initialize the joystick subsystem */
+SDL_InitSubSystem(SDL_INIT_JOYSTICK);
+
+/* Do some stuff with video and joystick */
+.
+.
+.
+/* Shut them both down */
+SDL_Quit(); Return Value Returns -1 on an error or 0 on success.
SDL_JoyAxisEvent Name SDL_JoyAxisEvent -- Joystick axis motion event structure
Structure Definition typedef struct{
+ Uint8 type;
+ Uint8 which;
+ Uint8 axis;
+ Sint16 value;
+} SDL_JoyAxisEvent; Structure Data
type SDL_JOYAXISMOTION which Joystick device index axis Joystick axis index value Axis value (range: -32768 to 32767)
Description SDL_JoyAxisEvent is a member of the SDL_Event SDL_JOYAXISMOTION is reported.
A SDL_JOYAXISMOTION event occurs when ever a user moves an axis on the joystick. The field which axis Joystick section ). value
SDL_JoyBallEvent Name SDL_JoyBallEvent -- Joystick trackball motion event structure
Structure Definition typedef struct{
+ Uint8 type;
+ Uint8 which;
+ Uint8 ball;
+ Sint16 xrel, yrel;
+} SDL_JoyBallEvent; Structure Data
type SDL_JOYBALLMOTION which Joystick device index ball Joystick trackball index xrel yrel The relative motion in the X/Y direction
Description SDL_JoyBallEvent is a member of the SDL_Event SDL_JOYBALLMOTION is reported.
A SDL_JOYBALLMOTION event occurs when a user moves a trackball on the joystick. The field which ball Joystick section ). Trackballs only return relative motion, this is the change in position on the ball since it was last polled (last cycle of the event loop) and it is stored in xrel yrel
SDL_JoyButtonEvent Name SDL_JoyButtonEvent -- Joystick button event structure
Structure Definition typedef struct{
+ Uint8 type;
+ Uint8 which;
+ Uint8 button;
+ Uint8 state;
+} SDL_JoyButtonEvent; Structure Data
type SDL_JOYBUTTONDOWN or SDL_JOYBUTTONUP which Joystick device index button Joystick button index state SDL_PRESSED or SDL_RELEASED
Description SDL_JoyButtonEvent is a member of the SDL_Event SDL_JOYBUTTONDOWN or SDL_JOYBUTTONUP is reported.
A SDL_JOYBUTTONDOWN or SDL_JOYBUTTONUP event occurs when ever a user presses or releases a button on a joystick. The field which button Joystick section ). state SDL_PRESSED or SDL_RELEASED .
SDL_JoyHatEvent Name SDL_JoyHatEvent -- Joystick hat position change event structure
Structure Definition typedef struct{
+ Uint8 type;
+ Uint8 which;
+ Uint8 hat;
+ Uint8 value;
+} SDL_JoyHatEvent; Structure Data
type SDL_JOY which Joystick device index hat Joystick hat index value Hat position
Description SDL_JoyHatEvent is a member of the SDL_Event SDL_JOYHATMOTION is reported.
A SDL_JOYHATMOTION event occurs when ever a user moves a hat on the joystick. The field which hat Joystick section ). value
SDL_HAT_CENTERED SDL_HAT_UP SDL_HAT_RIGHT SDL_HAT_DOWN SDL_HAT_LEFT
The following defines are also provided:
SDL_HAT_RIGHTUP SDL_HAT_RIGHTDOWN SDL_HAT_LEFTUP SDL_HAT_LEFTDOWN
SDL_JoystickClose Name SDL_JoystickClose -- Closes a previously opened joystick
Synopsis
#include "SDL.h" void SDL_JoystickClose (SDL_Joystick *joystick);
SDL_JoystickEventState Name SDL_JoystickEventState -- Enable/disable joystick event polling
Synopsis
#include "SDL.h" int SDL_JoystickEventState (int state);
Description This function is used to enable or disable joystick event processing. With joystick event processing disabled you will have to update joystick states with SDL_JoystickUpdate state SDL_QUERY , SDL_ENABLE or SDL_IGNORE .
Note: Joystick event handling is prefered
Return Value If state SDL_QUERY then the current state is returned, otherwise the new processing state
SDL_JoystickGetAxis Name SDL_JoystickGetAxis -- Get the current state of an axis
Synopsis
#include "SDL.h" Sint16 SDL_JoystickGetAxis (SDL_Joystick *joystick, int axis);
Description SDL_JoystickGetAxis returns the current state of the given axis joystick
On most modern joysticks the X axis is usually represented by axis axis SDL_JoystickGetAxis is a signed integer (-32768 to 32768) representing the current position of the axis
Return Value Returns a 16-bit signed integer representing the current position of the axis
Examples
Sint16 x_move, y_move;
+SDL_Joystick *joy1;
+.
+.
+x_move=SDL_JoystickGetAxis(joy1, 0);
+y_move=SDL_JoystickGetAxis(joy1, 1); SDL_JoystickGetBall Name SDL_JoystickGetBall -- Get relative trackball motion
Synopsis
#include "SDL.h" int SDL_JoystickGetBall (SDL_Joystick *joystick, int ball, int *dx, int *dy);
Description Get the ball
Trackballs can only return relative motion since the last call to SDL_JoystickGetBall , these motion deltas a placed into dx dy
Return Value Returns 0 on success or -1 on failure
Examples
int delta_x, delta_y;
+SDL_Joystick *joy;
+.
+.
+.
+SDL_JoystickUpdate();
+if(SDL_JoystickGetBall(joy, 0, &delta_x, &delta_y)==-1)
+ printf("TrackBall Read Error!\n");
+printf("Trackball Delta- X:%d, Y:%d\n", delta_x, delta_y); SDL_JoystickGetButton Name SDL_JoystickGetButton -- Get the current state of a given button on a given joystick
Synopsis
#include "SDL.h" Uint8 SDL_JoystickGetButton (SDL_Joystick *joystick, int button);
Description SDL_JoystickGetButton returns the current state of the given button joystick
Return Value 1 if the button is pressed. Otherwise, 0 .
SDL_JoystickGetHat Name SDL_JoystickGetHat -- Get the current state of a joystick hat
Synopsis
#include "SDL.h" Uint8 SDL_JoystickGetHat (SDL_Joystick *joystick, int hat);
Description SDL_JoystickGetHat returns the current state of the given hat joystick
Return Value The current state is returned as a Uint8 which is defined as an OR'd combination of one or more of the following
SDL_HAT_CENTERED SDL_HAT_UP SDL_HAT_RIGHT SDL_HAT_DOWN SDL_HAT_LEFT SDL_HAT_RIGHTUP SDL_HAT_RIGHTDOWN SDL_HAT_LEFTUP SDL_HAT_LEFTDOWN
SDL_JoystickIndex Name SDL_JoystickIndex -- Get the index of an SDL_Joystick.
Synopsis
#include "SDL.h" int SDL_JoystickIndex (SDL_Joystick *joystick);
Description Returns the index of a given SDL_Joystick structure.
Return Value Index number of the joystick.
SDL_JoystickName Name SDL_JoystickName -- Get joystick name.
Synopsis
#include "SDL.h" const char *SDL_JoystickName (int index);
Description Get the implementation dependent name of joystick. The index
Return Value Returns a char pointer to the joystick name.
Examples
/* Print the names of all attached joysticks */
+int num_joy, i;
+num_joy=SDL_NumJoysticks();
+printf("%d joysticks found\n", num_joy);
+for(i=0;i<num_joy;i++)
+ printf("%s\n", SDL_JoystickName(i)); SDL_JoystickNumAxes Name SDL_JoystickNumAxes -- Get the number of joystick axes
Synopsis
#include "SDL.h" int SDL_JoystickNumAxes (SDL_Joystick *joystick);
Description Return the number of axes available from a previously opened SDL_Joystick .
Return Value Number of axes.
SDL_JoystickNumBalls Name SDL_JoystickNumBalls -- Get the number of joystick trackballs
Synopsis
#include "SDL.h" int SDL_JoystickNumBalls (SDL_Joystick *joystick);
Description Return the number of trackballs available from a previously opened SDL_Joystick .
Return Value Number of trackballs.
SDL_JoystickNumButtons Name SDL_JoystickNumButtons -- Get the number of joysitck buttons
Synopsis
#include "SDL.h" int SDL_JoystickNumButtons (SDL_Joystick *joystick);
Description Return the number of buttons available from a previously opened SDL_Joystick .
Return Value Number of buttons.
SDL_JoystickNumHats Name SDL_JoystickNumHats -- Get the number of joystick hats
Synopsis
#include "SDL.h" int SDL_JoystickNumHats (SDL_Joystick *joystick);
Description Return the number of hats available from a previously opened SDL_Joystick .
Return Value Number of hats.
SDL_JoystickOpen Name SDL_JoystickOpen -- Opens a joystick for use.
Synopsis
#include "SDL.h" SDL_Joystick *SDL_JoystickOpen (int index);
Description Opens a joystick for use within SDL. The index
Return Value Returns a SDL_Joystick structure on success. NULL on failure.
Examples
SDL_Joystick *joy;
+// Check for joystick
+if(SDL_NumJoysticks()>0){
+ // Open joystick
+ joy=SDL_JoystickOpen(0);
+
+ if(joy)
+ {
+ printf("Opened Joystick 0\n");
+ printf("Name: %s\n", SDL_JoystickName(0));
+ printf("Number of Axes: %d\n", SDL_JoystickNumAxes(joy));
+ printf("Number of Buttons: %d\n", SDL_JoystickNumButtons(joy));
+ printf("Number of Balls: %d\n", SDL_JoystickNumBalls(joy));
+ }
+ else
+ printf("Couldn't open Joystick 0\n");
+
+ // Close if opened
+ if(SDL_JoystickOpened(0))
+ SDL_JoystickClose(joy);
+} SDL_JoystickOpened Name SDL_JoystickOpened -- Determine if a joystick has been opened
Synopsis
#include "SDL.h" int SDL_JoystickOpened (int index);
Description Determines whether a joystick has already been opened within the application. index
Return Value Returns 1 if the joystick has been opened, or 0 if it has not.
SDL_JoystickUpdate Name SDL_JoystickUpdate -- Updates the state of all joysticks
Synopsis
#include "SDL.h" void SDL_JoystickUpdate (void);
Description Updates the state(position, buttons, etc.) of all open joysticks. If joystick events have been enabled with SDL_JoystickEventState
SDLKey Name SDLKey -- Keysym definitions.
Description
Table 8-1. SDL Keysym definitions
SDLKey ASCII value Common name SDLK_BACKSPACE '\b' backspace SDLK_TAB '\t' tab SDLK_CLEAR clear SDLK_RETURN '\r' return SDLK_PAUSE pause SDLK_ESCAPE '^[' escape SDLK_SPACE ' ' space SDLK_EXCLAIM '!' exclaim SDLK_QUOTEDBL '"' quotedbl SDLK_HASH '#' hash SDLK_DOLLAR '$' dollar SDLK_AMPERSAND '&' ampersand SDLK_QUOTE ''' quote SDLK_LEFTPAREN '(' left parenthesis SDLK_RIGHTPAREN ')' right parenthesis SDLK_ASTERISK '*' asterisk SDLK_PLUS '+' plus sign SDLK_COMMA ',' comma SDLK_MINUS '-' minus sign SDLK_PERIOD '.' period SDLK_SLASH '/' forward slash SDLK_0 '0' 0 SDLK_1 '1' 1 SDLK_2 '2' 2 SDLK_3 '3' 3 SDLK_4 '4' 4 SDLK_5 '5' 5 SDLK_6 '6' 6 SDLK_7 '7' 7 SDLK_8 '8' 8 SDLK_9 '9' 9 SDLK_COLON ':' colon SDLK_SEMICOLON ';' semicolon SDLK_LESS '<' less-than sign SDLK_EQUALS '=' equals sign SDLK_GREATER '>' greater-than sign SDLK_QUESTION '?' question mark SDLK_AT '@' at SDLK_LEFTBRACKET '[' left bracket SDLK_BACKSLASH '\' backslash SDLK_RIGHTBRACKET ']' right bracket SDLK_CARET '^' caret SDLK_UNDERSCORE '_' underscore SDLK_BACKQUOTE '`' grave SDLK_a 'a' a SDLK_b 'b' b SDLK_c 'c' c SDLK_d 'd' d SDLK_e 'e' e SDLK_f 'f' f SDLK_g 'g' g SDLK_h 'h' h SDLK_i 'i' i SDLK_j 'j' j SDLK_k 'k' k SDLK_l 'l' l SDLK_m 'm' m SDLK_n 'n' n SDLK_o 'o' o SDLK_p 'p' p SDLK_q 'q' q SDLK_r 'r' r SDLK_s 's' s SDLK_t 't' t SDLK_u 'u' u SDLK_v 'v' v SDLK_w 'w' w SDLK_x 'x' x SDLK_y 'y' y SDLK_z 'z' z SDLK_DELETE '^?' delete SDLK_KP0 keypad 0 SDLK_KP1 keypad 1 SDLK_KP2 keypad 2 SDLK_KP3 keypad 3 SDLK_KP4 keypad 4 SDLK_KP5 keypad 5 SDLK_KP6 keypad 6 SDLK_KP7 keypad 7 SDLK_KP8 keypad 8 SDLK_KP9 keypad 9 SDLK_KP_PERIOD '.' keypad period SDLK_KP_DIVIDE '/' keypad divide SDLK_KP_MULTIPLY '*' keypad multiply SDLK_KP_MINUS '-' keypad minus SDLK_KP_PLUS '+' keypad plus SDLK_KP_ENTER '\r' keypad enter SDLK_KP_EQUALS '=' keypad equals SDLK_UP up arrow SDLK_DOWN down arrow SDLK_RIGHT right arrow SDLK_LEFT left arrow SDLK_INSERT insert SDLK_HOME home SDLK_END end SDLK_PAGEUP page up SDLK_PAGEDOWN page down SDLK_F1 F1 SDLK_F2 F2 SDLK_F3 F3 SDLK_F4 F4 SDLK_F5 F5 SDLK_F6 F6 SDLK_F7 F7 SDLK_F8 F8 SDLK_F9 F9 SDLK_F10 F10 SDLK_F11 F11 SDLK_F12 F12 SDLK_F13 F13 SDLK_F14 F14 SDLK_F15 F15 SDLK_NUMLOCK numlock SDLK_CAPSLOCK capslock SDLK_SCROLLOCK scrollock SDLK_RSHIFT right shift SDLK_LSHIFT left shift SDLK_RCTRL right ctrl SDLK_LCTRL left ctrl SDLK_RALT right alt SDLK_LALT left alt SDLK_RMETA right meta SDLK_LMETA left meta SDLK_LSUPER left windows key SDLK_RSUPER right windows key SDLK_MODE mode shift SDLK_HELP help SDLK_PRINT print-screen SDLK_SYSREQ SysRq SDLK_BREAK break SDLK_MENU menu SDLK_POWER power SDLK_EURO euro
+
+
Table 8-2. SDL modifier definitions
SDL Modifier Meaning KMOD_NONE No modifiers applicable KMOD_NUM Numlock is down KMOD_CAPS Capslock is down KMOD_LCTRL Left Control is down KMOD_RCTRL Right Control is down KMOD_RSHIFT Right Shift is down KMOD_LSHIFT Left Shift is down KMOD_RALT Right Alt is down KMOD_LALT Left Alt is down KMOD_CTRL A Control key is down KMOD_SHIFT A Shift key is down KMOD_ALT An Alt key is down
SDL_KeyboardEvent Name SDL_KeyboardEvent -- Keyboard event structure
Structure Definition typedef struct{
+ Uint8 type;
+ Uint8 state;
+ SDL_keysym keysym;
+} SDL_KeyboardEvent; Structure Data
type SDL_KEYDOWN or SDL_KEYUP state SDL_PRESSED or SDL_RELEASED keysym Contains key press information
Description SDL_KeyboardEvent is a member of the SDL_Event SDL_KEYDOWN or SDL_KEYUP is reported.
The type state type SDK_KEYUP or state SDL_RELEASED ) and when a key is pressed (type SDL_KEYDOWN or state SDL_PRESSED ). The information on what key was pressed or released is in the keysym
Note: Repeating SDL_KEYDOWN events will occur if key repeat is enabled (see SDL_EnableKeyRepeat
SDL_keysym Name SDL_keysym -- Keysym structure
Structure Definition typedef struct{
+ Uint8 scancode;
+ SDLKey sym;
+ SDLMod mod;
+ Uint16 unicode;
+} SDL_keysym; Structure Data
scancode Hardware specific scancode sym SDL virtual keysym mod Current key modifiers unicode Translated character
Description The SDL_keysym structure is used by reporting key presses and releases since it is a part of the SDL_KeyboardEvent
The scancode sym SDL Key Syms . This field is very useful when you are checking for certain key presses, like so:
+
.
+.
+while(SDL_PollEvent(&event)){
+ switch(event.type){
+ case SDL_KEYDOWN:
+ if(event.key.keysym.sym==SDLK_LEFT)
+ move_left();
+ break;
+ .
+ .
+ .
+ }
+}
+.
+.
+
mod stores the current state of the keyboard modifiers as explained in
SDL_GetModState . The
unicode is only used when UNICODE translation is enabled with
SDL_EnableUNICODE . If
unicode is non-zero then this a the UNICODE character corresponding to the keypress. If the high 9 bits of the character are 0, then this maps to the equivalent ASCII character:
+
char ch;
+if ( (keysym.unicode & 0xFF80) == 0 ) {
+ ch = keysym.unicode & 0x7F;
+}
+else {
+ printf("An International Character.\n");
+}
+UNICODE translation does have a slight overhead so don't enable it unless its needed.
SDL_KillThread Name SDL_KillThread -- Gracelessly terminates the thread.
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" void SDL_KillThread (SDL_Thread *thread);
Description SDL_KillThread gracelessly terminates the thread
+associated with thread
SDL_ListModes Name SDL_ListModes -- Returns a pointer to an array of available screen dimensions for
+the given format and video flags
Synopsis
#include "SDL.h" SDL_Rect **SDL_ListModes (SDL_PixelFormat *format, Uint32 flags);
Description Return a pointer to an array of available screen dimensions for the given
+format and video flags, sorted largest to smallest. Returns
+NULL if there are no dimensions available for a particular
+format, or -1 if any dimension is okay for
+the given format.
If format NULL , the mode list
+will be for the format returned by SDL_GetVideoInfo() ->vfmt flag surface flags. The flags are the same as those used SDL_SetVideoMode SDL_HWSURFACE as a flag only modes that support hardware video surfaces will be returned.
Example SDL_Rect **modes;
+int i;
+.
+.
+.
+
+/* Get available fullscreen/hardware modes */
+modes=SDL_ListModes(NULL, SDL_FULLSCREEN|SDL_HWSURFACE);
+
+/* Check is there are any modes available */
+if(modes == (SDL_Rect **)0){
+ printf("No modes available!\n");
+ exit(-1);
+}
+
+/* Check if our resolution is restricted */
+if(modes == (SDL_Rect **)-1){
+ printf("All resolutions available.\n");
+}
+else{
+ /* Print valid modes */
+ printf("Available Modes\n");
+ for(i=0;modes[i];++i)
+ printf(" %d x %d\n", modes[i]->w, modes[i]->h);
+}
+.
+. SDL_LoadBMP Name SDL_LoadBMP -- Load a Windows BMP file into an SDL_Surface.
Synopsis
#include "SDL.h" SDL_Surface *SDL_LoadBMP (const char *file);
Description Loads a surface from a named Windows BMP file.
Return Value Returns the new surface, or NULL
+if there was an error.
SDL_LoadWAV Name SDL_LoadWAV -- Load a WAVE file
Synopsis
#include "SDL.h" SDL_AudioSpec *SDL_LoadWAV (const char *file, SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len);
Description SDL_LoadWAV
+This function loads a WAVE file
If this function succeeds, it returns the given
+SDL_AudioSpec audio_buf malloc 'd
+buffer containing the audio data, and sets audio_len SDL_FreeWAV
This function returns NULL and sets the SDL
+error message if the wave file cannot be opened, uses an unknown data format,
+or is corrupt. Currently raw, MS-ADPCM and IMA-ADPCM WAVE files are supported.
Example SDL_AudioSpec wav_spec;
+Uint32 wav_length;
+Uint8 *wav_buffer;
+
+/* Load the WAV */
+if( SDL_LoadWAV("test.wav", &wav_spec, &wav_buffer, &wav_length) == NULL ){
+ fprintf(stderr, "Could not open test.wav: %s\n", SDL_GetError());
+ exit(-1);
+}
+.
+.
+.
+/* Do stuff with the WAV */
+.
+.
+/* Free It */
+SDL_FreeWAV(wav_buffer); SDL_LockAudio Name SDL_LockAudio -- Lock out the callback function
Synopsis
#include "SDL.h" void SDL_LockAudio (void);
Description The lock manipulated by these functions protects the callback function.
+During a LockAudio period, you can be guaranteed that the
+callback function is not running. Do not call these from the callback
+function or you will cause deadlock.
SDL_LockSurface Name SDL_LockSurface -- Lock a surface for directly access.
Synopsis
#include "SDL.h" int SDL_LockSurface (SDL_Surface *surface);
Description SDL_LockSurface sets up a surface for directly
+accessing the pixels. Between calls to SDL_LockSurface
+and SDL_UnlockSurface , you can write to and read from
+surface->pixels surface->format SDL_UnlockSurface to release it.
Not all surfaces require locking.
+If SDL_MUSTLOCK (surface 0 , then you can read and write to the
+surface at any time, and the pixel format of the surface will not change.
No operating system or library calls should be made between lock/unlock
+pairs, as critical system locks may be held during this time.
It should be noted, that since SDL 1.1.8 surface locks are recursive. This means that you can lock a surface multiple times, but each lock must have a match unlock.
+
.
+ .
+ SDL_LockSurface( surface );
+ .
+ /* Surface is locked */
+ /* Direct pixel access on surface here */
+ .
+ SDL_LockSurface( surface );
+ .
+ /* More direct pixel access on surface */
+ .
+ SDL_UnlockSurface( surface );
+ /* Surface is still locked */
+ /* Note: Is versions < 1.1.8, the surface would have been */
+ /* no longer locked at this stage */
+ .
+ SDL_UnlockSurface( surface );
+ /* Surface is now unlocked */
+ .
+ . Return Value SDL_LockSurface returns 0 ,
+or -1 if the surface couldn't be locked.
SDL_LockYUVOverlay Name SDL_LockYUVOverlay -- Lock an overlay
Synopsis
#include "SDL.h" int SDL_LockYUVOverlay (SDL_Overlay *overlay);
Description Much the same as SDL_LockSurface SDL_LockYUVOverlay locks the overlay
Return Value Returns 0 on success, or -1 on an error.
SDL_MapRGB Name SDL_MapRGB -- Map a RGB color value to a pixel format.
Synopsis
#include "SDL.h" Uint32 SDL_MapRGB (SDL_PixelFormat *fmt, Uint8 r, Uint8 g, Uint8 b);
Description Maps the RGB color value to the specified pixel format and returns the
+pixel value as a 32-bit int.
If the format has a palette (8-bit) the index of the closest matching
+color in the palette will be returned.
If the specified pixel format has an alpha component it will be returned
+as all 1 bits (fully opaque).
Return Value A pixel value best approximating the given RGB color value for a given
+pixel format. If the pixel format bpp (color depth) is less than 32-bpp
+then the unused upper bits of the return value can safely be ignored
+(e.g., with a 16-bpp format the return value can be assigned to a
+Uint16 , and similarly a Uint8 for an 8-bpp
+format).
SDL_MapRGBA Name SDL_MapRGBA -- Map a RGBA color value to a pixel format.
Synopsis
#include "SDL.h" Uint32 SDL_MapRGBA (SDL_PixelFormat *fmt, Uint8 r, Uint8 g, Uint8 b, Uint8 a);
Description Maps the RGBA color value to the specified pixel format and returns the
+pixel value as a 32-bit int.
If the format has a palette (8-bit) the index of the closest matching
+color in the palette will be returned.
If the specified pixel format has no alpha component the alpha value
+will be ignored (as it will be in formats with a palette).
Return Value A pixel value best approximating the given RGBA color value for a given
+pixel format. If the pixel format bpp (color depth) is less than 32-bpp
+then the unused upper bits of the return value can safely be ignored
+(e.g., with a 16-bpp format the return value can be assigned to a
+Uint16 , and similarly a Uint8 for an 8-bpp
+format).
SDL_MixAudio Name SDL_MixAudio -- Mix audio data
Synopsis
#include "SDL.h" void SDL_MixAudio (Uint8 *dst, Uint8 *src, Uint32 len, int volume);
Description This function takes two audio buffers of len volume SDL_MIX_MAXVOLUME and should be set to the maximum
+value for full audio volume. Note this does not change hardware volume. This is
+provided for convenience -- you can mix your own audio data.
Note: Do not use this function for mixing together more than two streams of sample
+data. The output from repeated application of this function may be distorted
+by clipping, because there is no accumulator with greater range than the
+input (not to mention this being an inefficient way of doing it).
+Use mixing functions from SDL_mixer, OpenAL, or write your own mixer instead.
SDL_MouseButtonEvent Name SDL_MouseButtonEvent -- Mouse button event structure
Structure Definition typedef struct{
+ Uint8 type;
+ Uint8 button;
+ Uint8 state;
+ Uint16 x, y;
+} SDL_MouseButtonEvent; Structure Data
type SDL_MOUSEBUTTONDOWN or SDL_MOUSEBUTTONUP button The mouse button index (SDL_BUTTON_LEFT, SDL_BUTTON_MIDDLE, SDL_BUTTON_RIGHT) state SDL_PRESSED or SDL_RELEASED x y The X/Y coordinates of the mouse at press/release time
Description SDL_MouseButtonEvent is a member of the SDL_Event SDL_MOUSEBUTTONDOWN or SDL_MOUSEBUTTONUP is reported.
When a mouse button press or release is detected then number of the button pressed (from 1 to 255, with 1 usually being the left button and 2 the right) is placed into button x y SDL_KeyboardEvent type state
SDL_MouseMotionEvent Name SDL_MouseMotionEvent -- Mouse motion event structure
Structure Definition typedef struct{
+ Uint8 type;
+ Uint8 state;
+ Uint16 x, y;
+ Sint16 xrel, yrel;
+} SDL_MouseMotionEvent; Structure Data
type SDL_MOUSEMOTION state The current button state x y The X/Y coordinates of the mouse xrel yrel Relative motion in the X/Y direction
Description SDL_MouseMotionEvent is a member of the SDL_Event SDL_MOUSEMOTION is reported.
Simply put, a SDL_MOUSEMOTION type event occurs when a user moves the mouse within the application window or when SDL_WarpMouse x y xrel yrel state SDL_BUTTON macro (see SDL_GetMouseState
If the cursor is hidden (SDL_ShowCursor (0)SDL_WM_GrabInput (SDL_GRAB_ON)
SDL_mutexP Name SDL_mutexP -- Lock a mutex
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" int SDL_mutexP (SDL_mutex *mutex);
Description Locks the mutex SDL_CreateMutex SDL_mutexP will not return until it is unlocked . Returns 0 on success, or -1 on an error.
SDL also defines a macro #define SDL_LockMutex(m) SDL_mutexP(m) .
SDL_mutexV Name SDL_mutexV -- Unlock a mutex
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" int SDL_mutexV (SDL_mutex *mutex);
Description Unlocks the mutex SDL_CreateMutex 0 on success, or -1 on an error.
SDL also defines a macro #define SDL_UnlockMutex(m) SDL_mutexV(m) .
SDL_NumJoysticks Name SDL_NumJoysticks -- Count available joysticks.
Synopsis
#include "SDL.h" int SDL_NumJoysticks (void);
Description Counts the number of joysticks attached to the system.
Return Value Returns the number of attached joysticks
SDL_OpenAudio Name SDL_OpenAudio -- Opens the audio device with the desired parameters.
Synopsis
#include "SDL.h" int SDL_OpenAudio (SDL_AudioSpec *desired, SDL_AudioSpec *obtained);
Description This function opens the audio device with the desired obtained obtained
To open the audio device a desired SDL_AudioSpec
SDL_AudioSpec *desired;
+.
+.
+desired = malloc(sizeof(SDL_AudioSpec));
+You must then fill this structure with your desired audio specifications.
desired ->freq The desired audio frequency in samples-per-second.
desired ->format The desired audio format (see SDL_AudioSpec
desired ->samples The desired size of the audio buffer in samples. This number should be a power of two, and may be adjusted by the audio driver to a value more suitable for the hardware. Good values seem to range between 512 and 8192 inclusive, depending on the application and CPU speed. Smaller values yield faster response time, but can lead to underflow if the application is doing heavy processing and cannot fill the audio buffer in time. A stereo sample consists of both right and left channels in LR ordering. Note that the number of samples is directly related to time by the following formula: ms = (samples*1000)/freq
desired ->callback This should be set to a function that will be called when the audio device is ready for more data. It is passed a pointer to the audio buffer, and the length in bytes of the audio buffer. This function usually runs in a separate thread, and so you should protect data structures that it accesses by calling SDL_LockAudio SDL_UnlockAudio
void callback(void *userdata, Uint8 *stream, int len);
+userdata userdata SDL_AudioSpec . stream len desired ->userdata This pointer is passed as the first parameter to the callback function.
SDL_OpenAudio reads these fields from the desired SDL_AudioSpec structure pass to the function and attempts to find an audio configuration matching your desired obtained NULL then SDL with convert from your desired
If obtained NULL then the desired SDL_AudioSpec is your working specification, otherwise the obtained SDL_AudioSpec becomes the working specification and the desirec SDL_AudioCVT 's for converting loaded data to the hardware format.
SDL_OpenAudio calculates the size silence desired obtained size silence
The audio device starts out playing silence SDL_PauseAudio (0 callback size
Examples /* Prototype of our callback function */
+void my_audio_callback(void *userdata, Uint8 *stream, int len);
+
+/* Open the audio device */
+SDL_AudioSpec *desired, *obtained;
+SDL_AudioSpec *hardware_spec;
+
+/* Allocate a desired SDL_AudioSpec */
+desired = malloc(sizeof(SDL_AudioSpec));
+
+/* Allocate space for the obtained SDL_AudioSpec */
+obtained = malloc(sizeof(SDL_AudioSpec));
+
+/* 22050Hz - FM Radio quality */
+desired->freq=22050;
+
+/* 16-bit signed audio */
+desired->format=AUDIO_S16LSB;
+
+/* Mono */
+desired->channels=0;
+
+/* Large audio buffer reduces risk of dropouts but increases response time */
+desired->samples=8192;
+
+/* Our callback function */
+desired->callback=my_audio_callback;
+
+desired->userdata=NULL;
+
+/* Open the audio device */
+if ( SDL_OpenAudio(desired, obtained) < 0 ){
+ fprintf(stderr, "Couldn't open audio: %s\n", SDL_GetError());
+ exit(-1);
+}
+/* desired spec is no longer needed */
+free(desired);
+hardware_spec=obtained;
+.
+.
+/* Prepare callback for playing */
+.
+.
+.
+/* Start playing */
+SDL_PauseAudio(0); SDL_Overlay Name SDL_Overlay -- YUV video overlay
Structure Definition typedef struct{
+ Uint32 format;
+ int w, h;
+ int planes;
+ Uint16 *pitches;
+ Uint8 **pixels;
+ Uint32 hw_overlay:1;
+} SDL_Overlay; Structure Data
format Overlay format (see below) w, h Width and height of overlay planes Number of planes in the overlay. Usually either 1 or 3 pitches An array of pitches, one for each plane. Pitch is the length of a row in bytes. pixels An array of pointers to teh data of each plane. The overlay should be locked before these pointers are used. hw_overlay This will be set to 1 if the overlay is hardware accelerated.
Description A SDL_Overlay is similar to a SDL_Surface pixels locked before use. The format
#define SDL_YV12_OVERLAY 0x32315659 /* Planar mode: Y + V + U */
+#define SDL_IYUV_OVERLAY 0x56555949 /* Planar mode: Y + U + V */
+#define SDL_YUY2_OVERLAY 0x32595559 /* Packed mode: Y0+U0+Y1+V0 */
+#define SDL_UYVY_OVERLAY 0x59565955 /* Packed mode: U0+Y0+V0+Y1 */
+#define SDL_YVYU_OVERLAY 0x55595659 /* Packed mode: Y0+V0+Y1+U0 */
+More information on YUV formats can be found at
http://www.webartz.com/fourcc/indexyuv.htm .
SDL_Palette Name SDL_Palette -- Color palette for 8-bit pixel formats
Structure Definition typedef struct{
+ int ncolors;
+ SDL_Color *colors;
+} SDL_Palette; Structure Data
ncolors Number of colors used in this palette colors Pointer to SDL_Color
Description Each pixel in an 8-bit surface is an index into the colors SDL_Palette structure store in SDL_PixelFormat SDL_Palette should never need to be created manually. It is automatically created when SDL allocates a SDL_PixelFormat for a surface. The colors values of a SDL_Surface SDL_SetColors
SDL_PauseAudio Name SDL_PauseAudio -- Pauses and unpauses the audio callback processing
Synopsis
#include "SDL.h" void SDL_PauseAudio (int pause_on);
Description This function pauses and unpauses the audio callback processing.
+It should be called with pause_on
SDL_PeepEvents Name SDL_PeepEvents -- Checks the event queue for messages and optionally returns them.
Synopsis
#include "SDL.h" int SDL_PeepEvents (SDL_Event *events, int numevents, SDL_eventaction action, Uint32 mask);
Description Checks the event queue for messages and optionally returns them.
If action SDL_ADDEVENT , up to
+numevents
If action SDL_PEEKEVENT , up to
+numevents mask
If action SDL_GETEVENT , up to
+numevents mask
The mask SDL_EVENTMASK (event_type
This function is thread-safe.
Return Value This function returns the number of events actually stored, or
+-1 if there was an error.
SDL_PixelFormat Name SDL_PixelFormat -- Stores surface format information
Structure Definition typedef struct SDL_PixelFormat {
+ SDL_Palette *palette;
+ Uint8 BitsPerPixel;
+ Uint8 BytesPerPixel;
+ Uint8 Rloss, Gloss, Bloss, Aloss;
+ Uint8 Rshift, Gshift, Bshift, Ashift;
+ Uint32 Rmask, Gmask, Bmask, Amask;
+ Uint32 colorkey;
+ Uint8 alpha;
+} SDL_PixelFormat; Structure Data
palette Pointer to the palette , or NULL if the BitsPerPixel BitsPerPixel The number of bits used to represent each pixel in a surface. Usually 8, 16, 24 or 32. BytesPerPixel The number of bytes used to represent each pixel in a surface. Usually one to four. [RGBA]mask Binary mask used to retrieve individual color values [RGBA]loss Precision loss of each color component (2[RGBA]loss ) [RGBA]shift Binary left shift of each color component in the pixel value colorkey Pixel value of transparent pixels alpha Overall surface alpha value
Description A SDL_PixelFormat describes the format of the pixel data stored at the pixels SDL_Surface SDL_PixelFormat in the format
If you wish to do pixel level modifications on a surface, then understanding how SDL stores its color information is essential.
8-bit pixel formats are the easiest to understand. Since its an 8-bit format, we have 8 BitsPerPixel BytesPerPixel BytesPerPixel palette colors surface ->pixels SDL_Color surface ->format palette colors
SDL_Surface *surface;
+SDL_PixelFormat *fmt;
+SDL_Color *color;
+Uint8 index;
+
+.
+.
+
+/* Create surface */
+.
+.
+fmt=surface->format;
+
+/* Check the bitdepth of the surface */
+if(fmt->BitsPerPixel!=8){
+ fprintf(stderr, "Not an 8-bit surface.\n");
+ return(-1);
+}
+
+/* Lock the surface */
+SDL_LockSurface(surface);
+
+/* Get the topleft pixel */
+index=*(Uint8 *)surface->pixels;
+color=fmt->palette->colors[index];
+
+/* Unlock the surface */
+SDL_UnlockSurface(surface);
+printf("Pixel Color-> Red: %d, Green: %d, Blue: %d. Index: %d\n",
+ color->r, color->g, color->b, index);
+.
+. Pixel formats above 8-bit are an entirely different experience. They are
+considered to be "TrueColor" formats and the color information is stored in the
+pixels themselves, not in a palette. The mask, shift and loss fields tell us
+how the color information is encoded. The mask fields allow us to isolate each
+color component, the shift fields tell us the number of bits to the right of
+each component in the pixel value and the loss fields tell us the number of
+bits lost from each component when packing 8-bit color component in a pixel.
+
/* Extracting color components from a 32-bit color value */
+SDL_PixelFormat *fmt;
+SDL_Surface *surface;
+Uint32 temp, pixel;
+Uint8 red, green, blue, alpha;
+.
+.
+.
+fmt=surface->format;
+SDL_LockSurface(surface);
+pixel=*((Uint32*)surface->pixels);
+SDL_UnlockSurface(surface);
+
+/* Get Red component */
+temp=pixel&fmt->Rmask; /* Isolate red component */
+temp=temp>>fmt->Rshift;/* Shift it down to 8-bit */
+temp=temp<<fmt->Rloss; /* Expand to a full 8-bit number */
+red=(Uint8)temp;
+
+/* Get Green component */
+temp=pixel&fmt->Gmask; /* Isolate green component */
+temp=temp>>fmt->Gshift;/* Shift it down to 8-bit */
+temp=temp<<fmt->Gloss; /* Expand to a full 8-bit number */
+green=(Uint8)temp;
+
+/* Get Blue component */
+temp=pixel&fmt->Bmask; /* Isolate blue component */
+temp=temp>>fmt->Bshift;/* Shift it down to 8-bit */
+temp=temp<<fmt->Bloss; /* Expand to a full 8-bit number */
+blue=(Uint8)temp;
+
+/* Get Alpha component */
+temp=pixel&fmt->Amask; /* Isolate alpha component */
+temp=temp>>fmt->Ashift;/* Shift it down to 8-bit */
+temp=temp<<fmt->Aloss; /* Expand to a full 8-bit number */
+alpha=(Uint8)temp;
+
+printf("Pixel Color -> R: %d, G: %d, B: %d, A: %d\n", red, green, blue, alpha);
+.
+.
+. SDL_PollEvent Name SDL_PollEvent -- Polls for currently pending events.
Synopsis
#include "SDL.h" int SDL_PollEvent (SDL_Event *event);
Description Polls for currently pending events, and returns 1
+if there are any pending events, or 0 if there
+are none available.
If event NULL , the next
+event is removed from the queue and stored in that area.
Examples
SDL_Event event; /* Event structure */
+
+.
+.
+.
+/* Check for events */
+while(SDL_PollEvent(&event)){ /* Loop until there are no events left on the queue */
+ switch(event.type){ /* Process the appropiate event type */
+ case SDL_KEYDOWN: /* Handle a KEYDOWN event */
+ printf("Oh! Key press\n");
+ break;
+ case SDL_MOUSEMOTION:
+ .
+ .
+ .
+ default: /* Report an unhandled event */
+ printf("I don't know what this event is!\n");
+ }
+} SDL_PumpEvents Name SDL_PumpEvents -- Pumps the event loop, gathering events from the input devices.
Synopsis
#include "SDL.h" void SDL_PumpEvents (void);
Description Pumps the event loop, gathering events from the input devices.
SDL_PumpEvents gathers all the pending input information from devices and places it on the event queue. Without calls to SDL_PumpEvents no events would ever be placed on the queue. Often calls the need for SDL_PumpEvents is hidden from the user since SDL_PollEvent SDL_WaitEvent SDL_PumpEvents . However, if you are not polling or waiting for events (e.g. you are filtering them), then you must call SDL_PumpEvents to force an event queue update.
Note: You can only call this function in the thread that set the video mode.
SDL_PushEvent Name SDL_PushEvent -- Pushes an event onto the event queue
Synopsis
#include "SDL.h" int SDL_PushEvent (SDL_Event *event);
Description The event queue can actually be used as a two way communication channel. Not only can events be read from the queue, but the user can also push their own events onto it. event
Note: Pushing device input events onto the queue doesn't modify the state of the device within SDL.
Return Value Returns 0 on success or -1 if the event couldn't be pushed.
SDL_Quit Name SDL_Quit -- Shut down SDL
Synopsis
#include "SDL.h" void SDL_Quit (void);
Description SDL_Quit shuts down all SDL subsystems and frees the resources allocated to them. This should always be called before you exit. For the sake of simplicity you can set SDL_Quit as your atexit call, like:
+
SDL_Init(SDL_INIT_VIDEO|SDL_INIT_AUDIO);
+atexit(SDL_Quit);
+.
+. Note: While using atexit maybe be fine for small programs, more advanced users should shut down SDL in their own cleanup code. Plus, using atexit in a library is a sure way to crash dynamically loaded code
SDL_QuitEvent Name SDL_QuitEvent -- Quit requested event
Structure Definition typedef struct{
+ Uint8 type
+} SDL_QuitEvent; Description SDL_QuitEvent is a member of the SDL_Event SDL_QUIT is reported.
As can be seen, the SDL_QuitEvent structure serves no useful purpose. The event itself, on the other hand, is very important. If you filter out or ignore a quit event then it is impossible for the user to close the window. On the other hand, if you do accept a quit event then the application window will be closed, and screen updates will still report success event though the application will no longer be visible.
Note: The macro SDL_QuitRequested will return non-zero if a quit event is pending
SDL_QuitSubSystem Name SDL_QuitSubSystem -- Shut down a subsystem
Synopsis
#include "SDL.h" void SDL_QuitSubSystem (Uint32 flags);
Description SDL_QuitSubSystem allows you to shut down a subsystem that has been previously initialized by SDL_Init SDL_InitSubSystem flags SDL_QuitSubSystem which subsystems to shut down, it uses the same values that are passed to SDL_Init
SDL_Rect Name SDL_Rect -- Defines a rectangular area
Structure Definition typedef struct{
+ Sint16 x, y;
+ Uint16 w, h;
+} SDL_Rect; Structure Data
x, y Position of the upper-left corner of the rectangle w, h The width and height of the rectangle
Description A SDL_Rect defines a rectangular area of pixels. It is used by SDL_BlitSurface
SDL_RemoveTimer Name SDL_RemoveTimer -- Remove a timer which was added with
+
SDL_AddTimer .
Synopsis
#include "SDL.h" SDL_bool SDL_RemoveTimer (SDL_TimerID id);
Description Removes a timer callback previously added with
+SDL_AddTimer .
Return Value Returns a boolean value indicating success.
Examples
SDL_RemoveTimer(my_timer_id); SDL_ResizeEvent Name SDL_ResizeEvent -- Window resize event structure
Structure Definition typedef struct{
+ Uint8 type;
+ int w, h;
+} SDL_ResizeEvent; Structure Data
type SDL_VIDEORESIZE w h New width and height of the window
Description SDL_ResizeEvent is a member of the SDL_Event SDL_VIDEORESIZE is reported.
When SDL_RESIZABLE is passed as a flag SDL_SetVideoMode SDL_VIDEORESIZE is report, with the new window width and height values stored in w h SDL_VIDEORESIZE is recieved the window should be resized to the new dimensions using SDL_SetVideoMode
SDL_SaveBMP Name SDL_SaveBMP -- Save an SDL_Surface as a Windows BMP file.
Synopsis
#include "SDL.h" int SDL_SaveBMP (SDL_Surface *surface, const char *file);
Description Saves the SDL_Surface surface file
Return Value Returns 0 if successful or
+-1
+if there was an error.
SDL_SemPost Name SDL_SemPost -- Unlock a semaphore.
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" int SDL_SemPost (SDL_sem *sem);
Description SDL_SemPost unlocks the semaphore pointed to by
+sem
SDL_SemPost should be called after a semaphore is locked by a successful call to
+SDL_SemWait ,
+SDL_SemTryWait or
+SDL_SemWaitTimeout .
Return Value Returns 0 if successful or
+-1 if there was an error (leaving the semaphore unchanged).
Examples
SDL_SemPost(my_sem); SDL_SemTryWait Name SDL_SemTryWait -- Attempt to lock a semaphore but don't suspend the thread.
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" int SDL_SemTryWait (SDL_sem *sem);
Description SDL_SemTryWait is a non-blocking varient of
+SDL_SemWait sem SDL_MUTEX_TIMEDOUT instead of suspending the thread.
After SDL_SemTryWait is successful, the semaphore
+can be released and its count atomically incremented by a successful call to
+SDL_SemPost .
Return Value Returns 0 if the semaphore was successfully locked or
+either SDL_MUTEX_TIMEDOUT or -1
+if the thread would have suspended or there was an error, respectivly.
If the semaphore was not successfully locked, the semaphore will be unchanged.
Examples
res = SDL_SemTryWait(my_sem);
+
+if (res == SDL_MUTEX_TIMEDOUT) {
+ return TRY_AGAIN;
+}
+if (res == -1) {
+ return WAIT_ERROR;
+}
+
+...
+
+SDL_SemPost(my_sem); SDL_SemValue Name SDL_SemValue -- Return the current value of a semaphore.
Synopsis
#include "SDL.h"
+#include "SDL/SDL_thread.h" Uint32 SDL_SemValue (SDL_sem *sem);
Description SDL_SemValue() returns the current semaphore value from
+the semaphore pointed to by sem
Return Value Returns current value of the semaphore.
Examples
sem_value = SDL_SemValue(my_sem); SDL_SemWait Name SDL_SemWait -- Lock a semaphore and suspend the thread if the semaphore value is zero.
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" int SDL_SemWait (SDL_sem *sem);
Description SDL_SemWait() suspends the calling thread until either
+the semaphore pointed to by sem
After SDL_SemWait() is successful, the semaphore
+can be released and its count atomically incremented by a successful call to
+SDL_SemPost .
Return Value Returns 0 if successful or
+-1 if there was an error (leaving the semaphore unchanged).
Examples
if (SDL_SemWait(my_sem) == -1) {
+ return WAIT_FAILED;
+}
+
+...
+
+SDL_SemPost(my_sem); SDL_SemWaitTimeout Name SDL_SemWaitTimeout -- Lock a semaphore, but only wait up to a specified maximum time.
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" int SDL_SemWaitTimeout (SDL_sem *sem, Uint32 timeout);
Description SDL_SemWaitTimeout() is a varient of
+SDL_SemWait
+with a maximum timeout value.
+If the value of the semaphore pointed to by sem timeout
After SDL_SemWaitTimeout() is successful, the semaphore
+can be released and its count atomically incremented by a successful call to
+SDL_SemPost .
Return Value Returns 0 if the semaphore was successfully locked or
+either SDL_MUTEX_TIMEDOUT or -1
+if the timeout period was exceeded or there was an error, respectivly.
If the semaphore was not successfully locked, the semaphore will be unchanged.
Examples
res = SDL_SemWaitTimeout(my_sem, WAIT_TIMEOUT_MILLISEC);
+
+if (res == SDL_MUTEX_TIMEDOUT) {
+ return TRY_AGAIN;
+}
+if (res == -1) {
+ return WAIT_ERROR;
+}
+
+...
+
+SDL_SemPost(my_sem); SDL_SetAlpha Name SDL_SetAlpha -- Adjust the alpha properties of a surface
Synopsis
#include "SDL.h" int SDL_SetAlpha (SDL_Surface *surface, Uint32 flag, Uint8 alpha);
Description Note: This function and the semantics of SDL alpha blending have changed since version 1.1.4. Up until version 1.1.5, an alpha value of 0 was considered opaque and a value of 255 was considered transparent. This has now been inverted: 0 (SDL_ALPHA_TRANSPARENT ) is now considered transparent and 255 (SDL_ALPHA_OPAQUE ) is now considered opaque.
SDL_SetAlpha is used for setting the per-surface alpha
+value and/or enabling and disabling alpha blending.
Thesurface flags SDL_SRCALPHA ) and
+whether the surface should use RLE acceleration for blitting
+(SDL_RLEACCEL ). flags SDL_SRCALPHA is not passed as a flag then all alpha
+information is ignored when blitting the surface. The
+alpha SDL_RLEACCEL .
Note: The per-surface alpha value of 128 is considered a special case and
+is optimised, so it's much faster than other per-surface values.
Alpha effects surface blitting in the following ways:
RGBA->RGB with SDL_SRCALPHA The source is alpha-blended with the destination, using the alpha channel. SDL_SRCCOLORKEY and the per-surface alpha are ignored.
RGBA->RGB without SDL_SRCALPHA The RGB data is copied from the source. The source alpha channel and the per-surface alpha value are ignored.
RGB->RGBA with SDL_SRCALPHA The source is alpha-blended with the destination using the per-surface alpha
+value. If SDL_SRCCOLORKEY is set, only the pixels not
+matching the colorkey value are copied. The alpha channel of the copied pixels
+is set to opaque.
RGB->RGBA without SDL_SRCALPHA The RGB data is copied from the source and the alpha value of the copied pixels
+is set to opaque. If SDL_SRCCOLORKEY is set, only the pixels
+not matching the colorkey value are copied.
RGBA->RGBA with SDL_SRCALPHA The source is alpha-blended with the destination using the source alpha
+channel. The alpha channel in the destination surface is left untouched.
+SDL_SRCCOLORKEY is ignored.
RGBA->RGBA without SDL_SRCALPHA The RGBA data is copied to the destination surface. If SDL_SRCCOLORKEY is set, only the pixels not matching the colorkey value are copied.
RGB->RGB with SDL_SRCALPHA The source is alpha-blended with the destination using the per-surface alpha value. If SDL_SRCCOLORKEY is set, only the pixels not matching the colorkey value are copied.
RGB->RGB without SDL_SRCALPHA The RGB data is copied from the source. If SDL_SRCCOLORKEY is set, only the pixels not matching the colorkey value are copied.
Note: Note that RGBA->RGBA blits (with SDL_SRCALPHA set) keep the alpha
+of the destination surface. This means that you cannot compose two arbitrary
+RGBA surfaces this way and get the result you would expect from "overlaying"
+them; the destination alpha will work as a mask.
Also note that per-pixel and per-surface alpha cannot be combined;
+the per-pixel alpha is always used if available
Return Value This function returns 0 , or
+-1 if there was an error.
SDL_SetClipRect Name SDL_SetClipRect -- Sets the clipping rectangle for a surface.
Synopsis
#include "SDL.h" void SDL_SetClipRect (SDL_Surface *surface, SDL_Rect *rect);
Description Sets the clipping rectangle for a surface. When this surface is the
+destination of a blit, only the area within the clip rectangle will be
+drawn into.
The rectangle pointed to by rect
If rect NULL the clipping
+rectangle will be set to the full size of the surface.
SDL_SetColorKey Name SDL_SetColorKey -- Sets the color key (transparent pixel) in a blittable surface and
+RLE acceleration.
Synopsis
#include "SDL.h" int SDL_SetColorKey (SDL_Surface *surface, Uint32 flag, Uint32 key);
Description Sets the color key (transparent pixel) in a blittable surface and enables or
+ disables RLE blit acceleration.
RLE acceleration can substantially speed up blitting of images with large
+horizontal runs of transparent pixels (i.e., pixels that match the
+key key surface SDL_MapRGB
If flag SDL_SRCCOLORKEY then
+key
If flag SDL_RLEACCEL then the surface will be draw using RLE
+acceleration when drawn with
+SDL_BlitSurface . The surface will
+actually be encoded for RLE acceleration the first time
+SDL_BlitSurface or
+SDL_DisplayFormat is called on the
+surface.
If flag
Return Value This function returns 0 , or
+-1 if there was an error.
SDL_SetColors Name SDL_SetColors -- Sets a portion of the colormap for the given 8-bit surface.
Synopsis
#include "SDL.h" int SDL_SetColors (SDL_Surface *surface, SDL_Color *colors, int firstcolor, int ncolors);
Description Sets a portion of the colormap for the given 8-bit surface.
When surface SDL_HWPALETTE was set in SDL_SetVideoMode flags,
+SDL_SetColors will always return 1 ,
+and the palette is guaranteed to be set the way you desire, even if the window
+colormap has to be warped or run under emulation.
The color components of a
+SDL_Color 3
+=16777216 colors.
Palettized (8-bit) screen surfaces with the SDL_HWPALETTE
+flag have two palettes, a logical palette that is used for mapping blits
+to/from the surface and a physical palette (that determines how the
+hardware will map the colors to the display). SDL_SetColors
+modifies both palettes (if present), and is equivalent to calling
+SDL_SetPalette with the
+flags (SDL_LOGPAL | SDL_PHYSPAL) .
Return Value If surface 0 . If all of the colors were set
+as passed to SDL_SetColors , it will return
+1 . If not all the color entries were set exactly as
+given, it will return 0 , and you should look at the
+surface palette to determine the actual color palette.
Example /* Create a display surface with a grayscale palette */
+SDL_Surface *screen;
+SDL_Color colors[256];
+int i;
+.
+.
+.
+/* Fill colors with color information */
+for(i=0;i<256;i++){
+ colors[i].r=i;
+ colors[i].g=i;
+ colors[i].b=i;
+}
+
+/* Create display */
+screen=SDL_SetVideoMode(640, 480, 8, SDL_HWPALETTE);
+if(!screen){
+ printf("Couldn't set video mode: %s\n", SDL_GetError());
+ exit(-1);
+}
+
+/* Set palette */
+SDL_SetColors(screen, colors, 0, 256);
+.
+.
+.
+. SDL_SetCursor Name SDL_SetCursor -- Set the currently active mouse cursor.
Synopsis
#include "SDL.h" void SDL_SetCursor (SDL_Cursor *cursor);
Description Sets the currently active cursor to
+the specified one.
+If the cursor is currently visible, the change will be immediately
+represented on the display.
SDL_SetEventFilter Name SDL_SetEventFilter -- Sets up a filter to process all events before they are posted
+to the event queue.
Synopsis
#include "SDL.h" void SDL_SetEventFilter (SDL_EventFilter filter);
Description This function sets up a filter to process all events before they are posted
+to the event queue. This is a very powerful and flexible feature. The filter
+is prototyped as:
+
typedef int (*SDL_EventFilter)(const SDL_Event *event);
+If the filter returns
1 , then the event will be
+added to the internal queue. If it returns
0 ,
+then the event will be dropped from the queue. This allows selective
+filtering of dynamically.
There is one caveat when dealing with the SDL_QUITEVENT event type. The
+event filter is only called when the window manager desires to close the
+application window. If the event filter returns 1, then the window will
+be closed, otherwise the window will remain open if possible.
+If the quit event is generated by an interrupt signal, it will bypass the
+internal queue and be delivered to the application at the next event poll.
Note: Be Careful!
SDL_SetGamma Name SDL_SetGamma -- Sets the color gamma function for the display
Synopsis
#include "SDL.h" int SDL_SetGamma (float redgamma, float greengamma, float bluegamma);
Description Sets the "gamma function" for the display of each color component. Gamma
+controls the brightness/contrast of colors displayed on the screen.
+A gamma value of 1.0 is identity (i.e., no adjustment
+is made).
This function adjusts the gamma based on the "gamma function" parameter,
+you can directly specify lookup tables for gamma adjustment with
+SDL_SetGammaRamp .
Not all display hardware is able to change gamma.
Return Value Returns -1 on error (or if gamma adjustment is not supported).
SDL_SetGammaRamp Name SDL_SetGammaRamp -- Sets the color gamma lookup tables for the display
Synopsis
#include "SDL.h" int SDL_SetGammaRamp (Uint16 *redtable, Uint16 *greentable, Uint16 *bluetable);
Description Sets the gamma lookup tables for the display for each color component.
+Each table is an array of 256 Uint16 values, representing a mapping
+between the input and output for that channel. The input is the index
+into the array, and the output is the 16-bit gamma value at that index,
+scaled to the output color precision. You may pass NULL to any of the
+channels to leave them unchanged.
This function adjusts the gamma based on lookup tables, you can also
+have the gamma calculated based on a "gamma function" parameter with
+SDL_SetGamma .
Not all display hardware is able to change gamma.
Return Value Returns -1 on error (or if gamma adjustment is not supported).
SDL_SetModState Name SDL_SetModState -- Set the current key modifier state
Synopsis
#include "SDL.h" void SDL_SetModState (SDLMod modstate);
Description The inverse of SDL_GetModState SDL_SetModState allows you to impose modifier key states on your application.
Simply pass your desired modifier states into modstate
typedef enum {
+ KMOD_NONE = 0x0000,
+ KMOD_LSHIFT= 0x0001,
+ KMOD_RSHIFT= 0x0002,
+ KMOD_LCTRL = 0x0040,
+ KMOD_RCTRL = 0x0080,
+ KMOD_LALT = 0x0100,
+ KMOD_RALT = 0x0200,
+ KMOD_LMETA = 0x0400,
+ KMOD_RMETA = 0x0800,
+ KMOD_NUM = 0x1000,
+ KMOD_CAPS = 0x2000,
+ KMOD_MODE = 0x4000,
+} SDLMod; SDL_SetPalette Name SDL_SetPalette -- Sets the colors in the palette of an 8-bit surface.
Synopsis
#include "SDL.h" int SDL_SetPalette (SDL_Surface *surface, int flags, SDL_Color *colors, int firstcolor, int ncolors);
Description Sets a portion of the palette for the given 8-bit surface.
Palettized (8-bit) screen surfaces with the
+SDL_HWPALETTE flag have two palettes, a logical
+palette that is used for mapping blits to/from the surface and a
+physical palette (that determines how the hardware will map the colors
+to the display). SDL_BlitSurface
+always uses the logical palette when blitting surfaces (if it has to
+convert between surface pixel formats). Because of this, it is often
+useful to modify only one or the other palette to achieve various
+special color effects (e.g., screen fading, color flashes, screen dimming).
This function can modify either the logical or physical palette by
+specifing SDL_LOGPAL or
+SDL_PHYSPAL the in the flags
When surface SDL_HWPALETTE was set in SDL_SetVideoMode flags,
+SDL_SetPalette will always return 1 ,
+and the palette is guaranteed to be set the way you desire, even if the window
+colormap has to be warped or run under emulation.
The color components of a
+SDL_Color 3 =16777216 colors.
Return Value If surface 0 . If all of the colors were set
+as passed to SDL_SetPalette , it will return
+1 . If not all the color entries were set exactly as
+given, it will return 0 , and you should look at the
+surface palette to determine the actual color palette.
Example /* Create a display surface with a grayscale palette */
+ SDL_Surface *screen;
+ SDL_Color colors[256];
+ int i;
+ .
+ .
+ .
+ /* Fill colors with color information */
+ for(i=0;i<256;i++){
+ colors[i].r=i;
+ colors[i].g=i;
+ colors[i].b=i;
+ }
+
+ /* Create display */
+ screen=SDL_SetVideoMode(640, 480, 8, SDL_HWPALETTE);
+ if(!screen){
+ printf("Couldn't set video mode: %s\n", SDL_GetError());
+ exit(-1);
+ }
+
+ /* Set palette */
+ SDL_SetPalette(screen, SDL_LOGPAL|SDL_PHYSPAL, colors, 0, 256);
+ .
+ .
+ .
+ . SDL_SetTimer SDL Library Documentation Prev
Name SDL_SetTimer -- Set a callback to run after the specified number of milliseconds has
+elapsed.
Synopsis
#include "SDL.h" int SDL_SetTimer (Uint32 interval, SDL_TimerCallback callback);
Callback /* Function prototype for the timer callback function */
+typedef Uint32 (*SDL_TimerCallback)(Uint32 interval);
Description Set a callback to run after the specified number of milliseconds has
+elapsed. The callback function is passed the current timer interval
+and returns the next timer interval. If the returned value is the
+same as the one passed in, the periodic alarm continues, otherwise a
+new alarm is scheduled.
To cancel a currently running timer, call
+SDL_SetTimer(0, NULL);
The timer callback function may run in a different thread than your
+main constant, and so shouldn't call any functions from within itself.
The maximum resolution of this timer is 10 ms, which means that if
+you request a 16 ms timer, your callback will run approximately 20 ms
+later on an unloaded system. If you wanted to set a flag signaling
+a frame update at 30 frames per second (every 33 ms), you might set a
+timer for 30 ms (see example below).
If you use this function, you need to pass SDL_INIT_TIMER
+to SDL_Init() .
Note: This function is kept for compatibility but has been superseded
+by the new timer functions
+SDL_AddTimer and
+SDL_RemoveTimer which support
+multiple timers.
Examples
SDL_SetTimer((33/10)*10, my_callback); SDL_SetVideoMode Name SDL_SetVideoMode -- Set up a video mode with the specified width, height and bits-per-pixel.
Synopsis
#include "SDL.h" SDL_Surface *SDL_SetVideoMode (int width, int height, int bpp, Uint32 flags);
Description Set up a video mode with the specified width, height and bits-per-pixel.
If bpp
The flags flags SDL_Surface
SDL_SWSURFACE Create the video surface in system memory SDL_HWSURFACE Create the video surface in video memory SDL_ASYNCBLIT Enables the use of asynchronous updates of the display surface. This will
+usually slow down blitting on single CPU machines, but may provide a speed
+increase on SMP systems. SDL_ANYFORMAT Normally, if a video surface of the requested bits-per-pixel (bpp SDL_ANYFORMAT prevents this and causes SDL to use the video surface, regardless of its pixel depth. SDL_HWPALETTE Give SDL exclusive palette access. Without this flag you may not always get the the colors you request with SDL_SetColors SDL_SetPalette SDL_DOUBLEBUF Enable hardware double buffering; only valid with SDL_HWSURFACE. Calling
+SDL_Flip SDL_Flip will just perform a
+SDL_UpdateRect SDL_FULLSCREEN SDL will attempt to use a fullscreen mode. If a hardware resolution change is
+not possible (for whatever reason), the next higher resolution will be used and
+the display window centered on a black background. SDL_OPENGL Create an OpenGL rendering context. You should have previously set OpenGL video attributes with SDL_GL_SetAttribute SDL_OPENGLBLIT Create an OpenGL rendering context, like above, but allow normal blitting
+operations. The screen (2D) surface may have an alpha channel, and
+SDL_UpdateRects not SDL_RESIZABLE Create a resizable window. When the window is resized by the user a SDL_VIDEORESIZE SDL_SetVideoMode can be called again with the new size. SDL_NOFRAME If possible, SDL_NOFRAME causes SDL to create a window with no title bar or frame decoration. Fullscreen modes automatically have this flag set.
Note: Whatever flags SDL_SetVideoMode could satisfy are set in the flags
Note: The bpp bpp bpp
Return Value The framebuffer surface, or NULL if it fails.
+The surface returned is freed by SDL_Quit() and should nt be freed by
+the caller.
SDL_ShowCursor Name SDL_ShowCursor -- Toggle whether or not the cursor is shown on the screen.
Synopsis
#include "SDL.h" int SDL_ShowCursor (int toggle);
Description Toggle whether or not the cursor is shown on the screen. Passing SDL_ENABLE displays the cursor and passing SDL_DISABLE hides it. The current state of the mouse cursor can be queried by passing SDL_QUERY , either SDL_DISABLE or SDL_ENABLE will be returned.
The cursor starts off displayed, but can be turned off.
Return Value Returns the current state of the cursor.
SDL_Surface Name SDL_Surface -- Graphical Surface Structure
Structure Definition typedef struct SDL_Surface {
+ Uint32 flags; /* Read-only */
+ SDL_PixelFormat *format; /* Read-only */
+ int w, h; /* Read-only */
+ Uint16 pitch; /* Read-only */
+ void *pixels; /* Read-write */
+
+ /* clipping information */
+ SDL_Rect clip_rect; /* Read-only */
+
+ /* Reference count -- used when freeing surface */
+ int refcount; /* Read-mostly */
+
+ /* This structure also contains private fields not shown here */
+} SDL_Surface; Structure Data
flags Surface flags format Pixel format w, h Width and height of the surface pitch Length of a surface scanline in bytes pixels Pointer to the actual pixel data clip_rect surface clip rectangle
Description SDL_Surface 's represent areas of "graphical"
+memory, memory that can be drawn to. The video framebuffer is returned
+as a SDL_Surface by
+SDL_SetVideoMode SDL_GetVideoSurface w h pixels locked
+before accessing this field. The clip_rect SDL_SetClipRect
The following are supported in the
+flags
SDL_SWSURFACE Surface is stored in system memory SDL_HWSURFACE Surface is stored in video memory SDL_ASYNCBLIT Surface uses asynchronous blits if possible SDL_ANYFORMAT Allows any pixel-format (Display surface) SDL_HWPALETTE Surface has exclusive palette SDL_DOUBLEBUF Surface is double buffered (Display surface) SDL_FULLSCREEN Surface is full screen (Display Surface) SDL_OPENGL Surface has an OpenGL context (Display Surface) SDL_OPENGLBLIT Surface supports OpenGL blitting (Display Surface) SDL_RESIZABLE Surface is resizable (Display Surface) SDL_HWACCEL Surface blit uses hardware acceleration SDL_SRCCOLORKEY Surface use colorkey blitting SDL_RLEACCEL Colorkey blitting is accelerated with RLE SDL_SRCALPHA Surface blit uses alpha blending SDL_PREALLOC Surface uses preallocated memory
SDL_SysWMEvent Name SDL_SysWMEvent -- Platform-dependent window manager event.
Description The system window manager event contains a pointer to system-specific
+information about unknown window manager events. If you enable this event
+using
+SDL_EventState()
typedef struct {
+ Uint8 type; /* Always SDL_SYSWMEVENT */
+ SDL_SysWMmsg *msg;
+ } SDL_SysWMEvent;
+
+If you want to obtain system-specific information about the window manager,
+you can fill the version member of a
SDL_SysWMinfo
+structure (details can be found in
SDL_syswm.h , which must be included) using the
SDL_VERSION() macro found in
+
SDL_version.h , and pass it to the
+function:
+
int SDL_GetWMInfo (SDL_SysWMinfo *info);
SDL_ThreadID Name SDL_ThreadID -- Get the 32-bit thread identifier for the current thread.
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" Uint32 SDL_ThreadID (void);
Description Get the 32-bit thread identifier for the current thread.
SDL_UnlockAudio Name SDL_UnlockAudio -- Unlock the callback function
Synopsis
#include "SDL.h" void SDL_UnlockAudio (void);
SDL_UnlockSurface Name SDL_UnlockSurface -- Unlocks a previously locked surface.
Synopsis
#include "SDL.h" void SDL_UnlockSurface (SDL_Surface *surface);
Description Surfaces that were previously locked using SDL_LockSurface must be unlocked with SDL_UnlockSurface . Surfaces should be unlocked as soon as possible.
It should be noted that since 1.1.8, surface locks are recursive. See SDL_LockSurface
SDL_UnlockYUVOverlay Name SDL_UnlockYUVOverlay -- Unlock an overlay
Synopsis
#include "SDL.h" void SDL_UnlockYUVOverlay (SDL_Overlay *overlay);
Description The opposite to SDL_LockYUVOverlay
SDL_UpdateRect Name SDL_UpdateRect -- Makes sure the given area is updated on the given screen.
Synopsis
#include "SDL.h" void SDL_UpdateRect (SDL_Surface *screen, Sint32 x, Sint32 y, Sint32 w, Sint32 h);
Description Makes sure the given area is updated on the given screen. The rectangle must
+be confined within the screen boundaries (no clipping is done).
If 'x y w h SDL_UpdateRect will update the
+entire screen.
This function should not be called while 'screen locked .
SDL_UpdateRects Name SDL_UpdateRects -- Makes sure the given list of rectangles is updated on the given screen.
Synopsis
#include "SDL.h" void SDL_UpdateRects (SDL_Surface *screen, int numrects, SDL_Rect *rects);
Description Makes sure the given list of rectangles is updated on the given screen.
+The rectangles must all be confined within the screen boundaries (no
+clipping is done).
This function should not be called while screen locked .
Note: It is adviced to call this function only once per frame, since each
+call has some processing overhead. This is no restriction since you
+can pass any number of rectangles each time.
The rectangles are not automatically merged or checked for overlap. In
+general, the programmer can use his knowledge about his particular
+rectangles to merge them in an efficient way, to avoid overdraw.
SDL_UserEvent Name SDL_UserEvent -- A user-defined event type
Structure Definition typedef struct{
+ Uint8 type;
+ int code;
+ void *data1;
+ void *data2;
+} SDL_UserEvent; Structure Data
type SDL_USEREVENT through to SDL_NUMEVENTS-1 code User defined event code data1 User defined data pointer data2 User defined data pointer
Description SDL_UserEvent is in the user SDL_Event SDL_PushEvent type SDL_USEREVENT to SDL_NUMEVENTS-1 (inclusive).
Examples
SDL_Event event;
+
+event.type = SDL_USEREVENT;
+event.user.code = my_event_code;
+event.user.data1 = significant_data;
+event.user.data2 = 0;
+SDL_PushEvent(&event); SDL_VideoDriverName Name SDL_VideoDriverName -- Obtain the name of the video driver
Synopsis
#include "SDL.h" char *SDL_VideoDriverName (char *namebuf, int maxlen);
Description The buffer pointed to by namebuf maxlen
Return Value Returns NULL if video has not been initialised with SDL_Init or a pointer to namebuf
SDL_VideoInfo Name SDL_VideoInfo -- Video Target information
Structure Definition typedef struct{
+ Uint32 hw_available:1;
+ Uint32 wm_available:1;
+ Uint32 blit_hw:1;
+ Uint32 blit_hw_CC:1;
+ Uint32 blit_hw_A:1;
+ Uint32 blit_sw:1;
+ Uint32 blit_sw_CC:1;
+ Uint32 blit_sw_A:1;
+ Uint32 blit_fill;
+ Uint32 video_mem;
+ SDL_PixelFormat *vfmt;
+} SDL_VideoInfo; Structure Data
hw_available Is it possible to create hardware surfaces? wm_available Is there a window manager available blit_hw Are hardware to hardware blits accelerated? blit_hw_CC Are hardware to hardware colorkey blits accelerated? blit_hw_A Are hardware to hardware alpha blits accelerated? blit_sw Are software to hardware blits accelerated? blit_sw_CC Are software to hardware colorkey blits accelerated? blit_sw_A Are software to hardware alpha blits accelerated? blit_fill Are color fills accelerated? video_mem Total amount of video memory in Kilobytes vfmt Pixel format of the video device
Description This (read-only) structure is returned by SDL_GetVideoInfo SDL_SetVideoMode
SDL_VideoModeOK Name SDL_VideoModeOK -- Check to see if a particular video mode is supported.
Synopsis
#include "SDL.h" int SDL_VideoModeOK (int width, int height, int bpp, Uint32 flags);
Description SDL_VideoModeOK returns 0
+if the requested mode is not supported under any bit depth, or returns the
+bits-per-pixel of the closest available mode with the given width, height and requested surface flags (see SDL_SetVideoMode
The bits-per-pixel value returned is only a suggested mode. You can usually request and bpp you want when setting the video mode and SDL will emulate that color depth with a shadow video surface.
The arguments to SDL_VideoModeOK are the same ones you
+would pass to SDL_SetVideoMode
Example SDL_Surface *screen;
+Uint32 bpp;
+.
+.
+.
+printf("Checking mode 640x480@16bpp.\n");
+bpp=SDL_VideoModeOK(640, 480, 16, SDL_HWSURFACE);
+
+if(!bpp){
+ printf("Mode not available.\n");
+ exit(-1);
+}
+
+printf("SDL Recommends 640x480@%dbpp.\n", bpp);
+screen=SDL_SetVideoMode(640, 480, bpp, SDL_HWSURFACE);
+.
+. SDL_WaitEvent Name SDL_WaitEvent -- Waits indefinitely for the next available event.
Synopsis
#include "SDL.h" int SDL_WaitEvent (SDL_Event *event);
Description Waits indefinitely for the next available event, returning
+1 , or 0 if there was
+an error while waiting for events.
If event NULL , the next
+event is removed from the queue and stored in that area.
SDL_WaitThread Name SDL_WaitThread -- Wait for a thread to finish.
Synopsis
#include "SDL.h"
+#include "SDL_thread.h" void SDL_WaitThread (SDL_Thread *thread, int *status);
Description Wait for a thread to finish (timeouts are not supported).
Return Value The return code for the thread function is placed in the area pointed to by
+status status NULL .
SDL_WarpMouse Name SDL_WarpMouse -- Set the position of the mouse cursor.
Synopsis
#include "SDL.h" void SDL_WarpMouse (Uint16 x, Uint16 y);
Description Set the position of the mouse cursor (generates a mouse motion event).
SDL_WasInit Name SDL_WasInit -- Check which subsystems are initialized
Synopsis
#include "SDL.h" Uint32 SDL_WasInit (Uint32 flags);
Description SDL_WasInit allows you to see which SDL subsytems have been initialized . flags SDL_Init
Return Value SDL_WasInit returns a bitwised OR'd combination of the initialized subsystems.
Examples
/* Here are several ways you can use SDL_WasInit() */
+
+/* Get init data on all the subsystems */
+Uint32 subsystem_init;
+
+subsystem_init=SDL_WasInit(SDL_INIT_EVERYTHING);
+
+if(subsystem_init&SDL_INIT_VIDEO)
+ printf("Video is initialized.\n");
+else
+ printf("Video is not initialized.\n");
+
+
+
+/* Just check for one specfic subsystem */
+
+if(SDL_WasInit(SDL_INIT_VIDEO)!=0)
+ printf("Video is initialized.\n");
+else
+ printf("Video is not initialized.\n");
+
+
+
+
+/* Check for two subsystems */
+
+Uint32 subsystem_mask=SDL_INIT_VIDEO|SDL_INIT_AUDIO;
+
+if(SDL_WasInit(subsystem_mask)==subsystem_mask)
+ printf("Video and Audio initialized.\n");
+else
+ printf("Video and Audio not initialized.\n");
SDL_WM_GetCaption Name SDL_WM_GetCaption -- Gets the window title and icon name.
Synopsis
#include "SDL.h" void SDL_WM_GetCaption (char **title, char **icon);
Description Set pointers to the window title icon
SDL_WM_GrabInput Name SDL_WM_GrabInput -- Grabs mouse and keyboard input.
Synopsis
#include "SDL.h" SDL_GrabMode SDL_WM_GrabInput (SDL_GrabMode mode);
Description Grabbing means that the mouse is confined to the application window,
+and nearly all keyboard input is passed directly to the application,
+and not interpreted by a window manager, if any.
When mode SDL_GRAB_QUERY the grab mode is not changed, but the current grab mode is returned.
typedef enum {
+ SDL_GRAB_QUERY,
+ SDL_GRAB_OFF,
+ SDL_GRAB_ON
+} SDL_GrabMode;
+
Return Value The current/new SDL_GrabMode .
SDL_WM_IconifyWindow Name SDL_WM_IconifyWindow -- Iconify/Minimise the window
Synopsis
#include "SDL.h" int SDL_WM_IconifyWindow (void);
Description If the application is running in a window managed environment SDL attempts to iconify/minimise it. If SDL_WM_IconifyWindow is successful, the application will receive a SDL_APPACTIVE
Return Value Returns non-zero on success or 0 if iconification is not support or was refused by the window manager.
SDL_WM_SetCaption Name SDL_WM_SetCaption -- Sets the window tile and icon name.
Synopsis
#include "SDL.h" void SDL_WM_SetCaption (const char *title, const char *icon);
Description Sets the title-bar and icon name of the display window.
SDL_WM_SetIcon Name SDL_WM_SetIcon -- Sets the icon for the display window.
Synopsis
#include "SDL.h" void SDL_WM_SetIcon (SDL_Surface *icon, Uint8 *mask);
Description Sets the icon for the display window. Win32 icons must be 32x32.
This function must be called before the first call to
+SDL_SetVideoMode .
The mask mask icon
If mask
Example SDL_WM_SetIcon(SDL_LoadBMP("icon.bmp"), NULL); SDL_WM_ToggleFullScreen Name SDL_WM_ToggleFullScreen -- Toggles fullscreen mode
Synopsis
#include "SDL.h" int SDL_WM_ToggleFullScreen (SDL_Surface *surface);
Description Toggles the application between windowed and fullscreen mode, if supported. (X11 is the only target currently supported, BeOS support is experimental).
Return Value Returns 0 on failure or 1 on success.
Multi-threaded Programming SDL provides functions for creating threads, mutexes, semphores and condition variables.
In general, you must be very aware of concurrency and data integrity issues
+when writing multi-threaded programs. Some good guidelines include:
+
Don't call SDL video/event functions from separate threads
Don't use any library functions in separate threads
Don't perform any memory management in separate threads
Lock global variables which may be accessed by multiple threads
Never terminate threads, always set a flag and wait for them to quit
Think very carefully about all possible ways your code may interact
Note: SDL's threading is not implemented on MacOS, due to that lack of preemptive thread support (Mac OS X dos nt suffer from this problem)
Time Table of Contents SDL_GetTicks -- Get the number of milliseconds since the SDL library initialization.SDL_Delay -- Wait a specified number of milliseconds before returning.SDL_AddTimer -- Add a timer which will call a callback after the specified number of milliseconds has
+elapsed.SDL_RemoveTimer -- Remove a timer which was added with
+SDL_AddTimer .SDL_SetTimer -- Set a callback to run after the specified number of milliseconds has
+elapsed.SDL provides several cross-platform functions for dealing with time.
+It provides a way to get the current time, a way to wait a little while,
+and a simple timer mechanism. These functions give you two ways of moving an
+object every x milliseconds:
+
+
Use a timer callback function. This may have the bad effect that it runs in a seperate thread or uses alarm signals, but it's easier to implement.
Or you can get the number of milliseconds passed, and move the object if, for example, 30 ms passed.
Video SDL presents a very simple interface to the display framebuffer. The
+framebuffer is represented as an offscreen surface to which you can write
+directly. If you want the screen to show what you have written, call the update function which will
+guarantee that the desired portion of the screen is updated.
Before you call any of the SDL video functions, you must first call
+SDL_Init(SDL_INIT_VIDEO) , which initializes the video
+and events in the SDL library. Check the return code, which should be
+0 , to see if there were any errors in starting up.
If you use both sound and video in your application, you need to call
+SDL_Init(SDL_INIT_AUDIO | SDL_INIT_VIDEO) before opening the
+sound device, otherwise under Win32 DirectX, you won't be able to set
+full-screen display modes.
After you have initialized the library, you can start up the video display in a
+number of ways. The easiest way is to pick a common screen resolution and
+depth and just initialize the video, checking for errors. You will probably
+get what you want, but SDL may be emulating your requested mode and converting
+the display on update. The best way is to
+query , for the best
+video mode closest to the desired one, and then
+convert
+your images to that pixel format.
SDL currently supports any bit depth >= 8 bits per pixel. 8 bpp formats are
+considered 8-bit palettized modes, while 12, 15, 16, 24, and 32 bits per pixel
+are considered "packed pixel" modes, meaning each pixel contains the RGB color
+components packed in the bits of the pixel.
After you have initialized your video mode, you can take the surface that was
+returned, and write to it like any other framebuffer, calling the update
+routine as you go.
When you have finished your video access and are ready to quit your
+application, you should call "SDL_Quit() " to shutdown the
+video and events.
Window Management SDL provides a small set of window management functions which allow applications to change their title and toggle from windowed mode to fullscreen (if available)
Simple DirectMedia Layer Introduction
+
+
+
+
+
+This library is designed to make it easy to write games that run on many
+different platforms using the various native high-performance media interfaces,
+(for video, audio, etc) and presenting a single source-code level API to
+your application. This is a fairly low level API, but using this, completely
+portable applications can be written with a great deal of flexibility.
+
+An introduction to SDL can be found online at:
+
+ http://www.libsdl.org/intro.php
+
+Tutorials on a variety of topics can be found online at:
+
+ http://www.libsdl.org/tutorials.php
+
+Documentation in Wiki form can be found online at:
+
+ http://www.libsdl.org/cgi/docwiki.cgi/
+
+Enjoy!
+
+ Sam Lantinga
+<slouken@libsdl.org >
+
+
+
Table of Contents
+
+
+
+typedef SInt8 int8_t;
+typedef UInt8 uint8_t;
+typedef SInt16 int16_t;
+typedef UInt16 uint16_t;
+typedef SInt32 int32_t;
+typedef UInt32 uint32_t;
+typedef SInt64 int64_t;
+typedef UInt64 uint64_t;
+typedef unsigned long uintptr_t;
+
+#define SDL_HAS_64BIT_TYPE 1
+
+/* Useful headers */
+#define HAVE_STDIO_H 1
+#define STDC_HEADERS 1
+#define HAVE_STRING_H 1
+#define HAVE_CTYPE_H 1
+#define HAVE_MATH_H 1
+#define HAVE_SIGNAL_H 1
+
+/* C library functions */
+#define HAVE_MALLOC 1
+#define HAVE_CALLOC 1
+#define HAVE_REALLOC 1
+#define HAVE_FREE 1
+#define HAVE_ALLOCA 1
+#define HAVE_ABS 1
+#define HAVE_MEMSET 1
+#define HAVE_MEMCPY 1
+#define HAVE_MEMMOVE 1
+#define HAVE_MEMCMP 1
+#define HAVE_STRLEN 1
+#define HAVE_STRCHR 1
+#define HAVE_STRRCHR 1
+#define HAVE_STRSTR 1
+#define HAVE_ITOA 1
+#define HAVE_STRTOL 1
+#define HAVE_STRTOD 1
+#define HAVE_ATOI 1
+#define HAVE_ATOF 1
+#define HAVE_STRCMP 1
+#define HAVE_STRNCMP 1
+#define HAVE_SSCANF 1
+
+/* Enable various audio drivers */
+#define SDL_AUDIO_DRIVER_SNDMGR 1
+#define SDL_AUDIO_DRIVER_DISK 1
+#define SDL_AUDIO_DRIVER_DUMMY 1
+
+/* Enable various cdrom drivers */
+#if TARGET_API_MAC_CARBON
+#define SDL_CDROM_DUMMY 1
+#else
+#define SDL_CDROM_MACOS 1
+#endif
+
+/* Enable various input drivers */
+#if TARGET_API_MAC_CARBON
+#define SDL_JOYSTICK_DUMMY 1
+#else
+#define SDL_JOYSTICK_MACOS 1
+#endif
+
+/* Enable various shared object loading systems */
+#define SDL_LOADSO_MACOS 1
+
+/* Enable various threading systems */
+#define SDL_THREADS_DISABLED 1
+
+/* Enable various timer systems */
+#define SDL_TIMER_MACOS 1
+
+/* Enable various video drivers */
+#define SDL_VIDEO_DRIVER_DUMMY 1
+#define SDL_VIDEO_DRIVER_DRAWSPROCKET 1
+#define SDL_VIDEO_DRIVER_TOOLBOX 1
+
+/* Enable OpenGL support */
+#define SDL_VIDEO_OPENGL 1
+
+#endif /* _SDL_config_macos_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_macosx.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_macosx.h
new file mode 100644
index 000000000..295b87245
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_macosx.h
@@ -0,0 +1,150 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+#ifndef _SDL_config_macosx_h
+#define _SDL_config_macosx_h
+
+#include "SDL_platform.h"
+
+/* This gets us MAC_OS_X_VERSION_MIN_REQUIRED... */
+#include
+
+/* This is a set of defines to configure the SDL features */
+
+#define SDL_HAS_64BIT_TYPE 1
+
+/* Useful headers */
+/* If we specified an SDK or have a post-PowerPC chip, then alloca.h exists. */
+#if ( (MAC_OS_X_VERSION_MIN_REQUIRED >= 1030) || (!defined(__POWERPC__)) )
+#define HAVE_ALLOCA_H 1
+#endif
+#define HAVE_SYS_TYPES_H 1
+#define HAVE_STDIO_H 1
+#define STDC_HEADERS 1
+#define HAVE_STRING_H 1
+#define HAVE_INTTYPES_H 1
+#define HAVE_STDINT_H 1
+#define HAVE_CTYPE_H 1
+#define HAVE_MATH_H 1
+#define HAVE_SIGNAL_H 1
+
+/* C library functions */
+#define HAVE_MALLOC 1
+#define HAVE_CALLOC 1
+#define HAVE_REALLOC 1
+#define HAVE_FREE 1
+#define HAVE_ALLOCA 1
+#define HAVE_GETENV 1
+#define HAVE_PUTENV 1
+#define HAVE_UNSETENV 1
+#define HAVE_QSORT 1
+#define HAVE_ABS 1
+#define HAVE_BCOPY 1
+#define HAVE_MEMSET 1
+#define HAVE_MEMCPY 1
+#define HAVE_MEMMOVE 1
+#define HAVE_MEMCMP 1
+#define HAVE_STRLEN 1
+#define HAVE_STRLCPY 1
+#define HAVE_STRLCAT 1
+#define HAVE_STRDUP 1
+#define HAVE_STRCHR 1
+#define HAVE_STRRCHR 1
+#define HAVE_STRSTR 1
+#define HAVE_STRTOL 1
+#define HAVE_STRTOUL 1
+#define HAVE_STRTOLL 1
+#define HAVE_STRTOULL 1
+#define HAVE_STRTOD 1
+#define HAVE_ATOI 1
+#define HAVE_ATOF 1
+#define HAVE_STRCMP 1
+#define HAVE_STRNCMP 1
+#define HAVE_STRCASECMP 1
+#define HAVE_STRNCASECMP 1
+#define HAVE_SSCANF 1
+#define HAVE_SNPRINTF 1
+#define HAVE_VSNPRINTF 1
+#define HAVE_SIGACTION 1
+#define HAVE_SETJMP 1
+#define HAVE_NANOSLEEP 1
+
+/* Enable various audio drivers */
+#define SDL_AUDIO_DRIVER_COREAUDIO 1
+#define SDL_AUDIO_DRIVER_DISK 1
+#define SDL_AUDIO_DRIVER_DUMMY 1
+
+/* Enable various cdrom drivers */
+#define SDL_CDROM_MACOSX 1
+
+/* Enable various input drivers */
+#define SDL_JOYSTICK_IOKIT 1
+
+/* Enable various shared object loading systems */
+#ifdef __ppc__
+/* For Mac OS X 10.2 compatibility */
+#define SDL_LOADSO_DLCOMPAT 1
+#else
+#define SDL_LOADSO_DLOPEN 1
+#endif
+
+/* Enable various threading systems */
+#define SDL_THREAD_PTHREAD 1
+#define SDL_THREAD_PTHREAD_RECURSIVE_MUTEX 1
+
+/* Enable various timer systems */
+#define SDL_TIMER_UNIX 1
+
+/* Enable various video drivers */
+#define SDL_VIDEO_DRIVER_DUMMY 1
+#if ((defined TARGET_API_MAC_CARBON) && (TARGET_API_MAC_CARBON))
+#define SDL_VIDEO_DRIVER_TOOLBOX 1
+#else
+#define SDL_VIDEO_DRIVER_QUARTZ 1
+#endif
+#define SDL_VIDEO_DRIVER_DGA 1
+#define SDL_VIDEO_DRIVER_X11 1
+#define SDL_VIDEO_DRIVER_X11_DGAMOUSE 1
+#define SDL_VIDEO_DRIVER_X11_DYNAMIC "/usr/X11R6/lib/libX11.6.dylib"
+#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XEXT "/usr/X11R6/lib/libXext.6.dylib"
+#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XRANDR "/usr/X11R6/lib/libXrandr.2.dylib"
+#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XRENDER "/usr/X11R6/lib/libXrender.1.dylib"
+#define SDL_VIDEO_DRIVER_X11_VIDMODE 1
+#define SDL_VIDEO_DRIVER_X11_XINERAMA 1
+#define SDL_VIDEO_DRIVER_X11_XME 1
+#define SDL_VIDEO_DRIVER_X11_XRANDR 1
+#define SDL_VIDEO_DRIVER_X11_XV 1
+
+/* Enable OpenGL support */
+#define SDL_VIDEO_OPENGL 1
+#define SDL_VIDEO_OPENGL_GLX 1
+
+/* Disable screensaver */
+#define SDL_VIDEO_DISABLE_SCREENSAVER 1
+
+/* Enable assembly routines */
+#define SDL_ASSEMBLY_ROUTINES 1
+#ifdef __ppc__
+#define SDL_ALTIVEC_BLITTERS 1
+#endif
+
+#endif /* _SDL_config_macosx_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_minimal.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_minimal.h
new file mode 100644
index 000000000..002c56ead
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_minimal.h
@@ -0,0 +1,62 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+#ifndef _SDL_config_minimal_h
+#define _SDL_config_minimal_h
+
+#include "SDL_platform.h"
+
+/* This is the minimal configuration that can be used to build SDL */
+
+#include
+
+typedef signed char int8_t;
+typedef unsigned char uint8_t;
+typedef signed short int16_t;
+typedef unsigned short uint16_t;
+typedef signed int int32_t;
+typedef unsigned int uint32_t;
+typedef unsigned int size_t;
+typedef unsigned long uintptr_t;
+
+/* Enable the dummy audio driver (src/audio/dummy/\*.c) */
+#define SDL_AUDIO_DRIVER_DUMMY 1
+
+/* Enable the stub cdrom driver (src/cdrom/dummy/\*.c) */
+#define SDL_CDROM_DISABLED 1
+
+/* Enable the stub joystick driver (src/joystick/dummy/\*.c) */
+#define SDL_JOYSTICK_DISABLED 1
+
+/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */
+#define SDL_LOADSO_DISABLED 1
+
+/* Enable the stub thread support (src/thread/generic/\*.c) */
+#define SDL_THREADS_DISABLED 1
+
+/* Enable the stub timer support (src/timer/dummy/\*.c) */
+#define SDL_TIMERS_DISABLED 1
+
+/* Enable the dummy video driver (src/video/dummy/\*.c) */
+#define SDL_VIDEO_DRIVER_DUMMY 1
+
+#endif /* _SDL_config_minimal_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_nds.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_nds.h
new file mode 100644
index 000000000..4ac60a504
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_nds.h
@@ -0,0 +1,115 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+#ifndef _SDL_config_nds_h
+#define _SDL_config_nds_h
+
+#include "SDL_platform.h"
+
+/* This is a set of defines to configure the SDL features */
+
+/* General platform specific identifiers */
+#include "SDL_platform.h"
+
+/* C datatypes */
+#define SDL_HAS_64BIT_TYPE 1
+
+/* Endianness */
+#define SDL_BYTEORDER 1234
+
+/* Useful headers */
+#define HAVE_ALLOCA_H 1
+#define HAVE_SYS_TYPES_H 1
+#define HAVE_STDIO_H 1
+#define STDC_HEADERS 1
+#define HAVE_STDLIB_H 1
+#define HAVE_STDARG_H 1
+#define HAVE_MALLOC_H 1
+#define HAVE_STRING_H 1
+#define HAVE_INTTYPES_H 1
+#define HAVE_STDINT_H 1
+#define HAVE_CTYPE_H 1
+#define HAVE_MATH_H 1
+#define HAVE_ICONV_H 1
+#define HAVE_SIGNAL_H 1
+
+/* C library functions */
+#define HAVE_MALLOC 1
+#define HAVE_CALLOC 1
+#define HAVE_REALLOC 1
+#define HAVE_FREE 1
+#define HAVE_ALLOCA 1
+#define HAVE_GETENV 1
+#define HAVE_PUTENV 1
+#define HAVE_UNSETENV 1
+#define HAVE_QSORT 1
+#define HAVE_ABS 1
+#define HAVE_BCOPY 1
+#define HAVE_MEMSET 1
+#define HAVE_MEMCPY 1
+#define HAVE_MEMMOVE 1
+#define HAVE_STRLEN 1
+#define HAVE_STRLCPY 1
+#define HAVE_STRLCAT 1
+#define HAVE_STRDUP 1
+#define HAVE_STRCHR 1
+#define HAVE_STRRCHR 1
+#define HAVE_STRSTR 1
+#define HAVE_STRTOL 1
+#define HAVE_STRTOUL 1
+#define HAVE_STRTOLL 1
+#define HAVE_STRTOULL 1
+#define HAVE_ATOI 1
+#define HAVE_ATOF 1
+#define HAVE_STRCMP 1
+#define HAVE_STRNCMP 1
+#define HAVE_STRCASECMP 1
+#define HAVE_STRNCASECMP 1
+#define HAVE_SSCANF 1
+#define HAVE_SNPRINTF 1
+#define HAVE_VSNPRINTF 1
+#define HAVE_SETJMP 1
+
+/* Enable various audio drivers */
+#define SDL_AUDIO_DRIVER_NDS 1
+#define SDL_AUDIO_DRIVER_DUMMY 1
+
+/* Enable the stub cdrom driver (src/cdrom/dummy/\*.c) */
+#define SDL_CDROM_DISABLED 1
+
+/* Enable various input drivers */
+#define SDL_JOYSTICK_NDS 1
+
+/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */
+#define SDL_LOADSO_DISABLED 1
+
+/* Enable the stub thread support (src/thread/generic/\*.c) */
+#define SDL_THREADS_DISABLED 1
+
+/* Enable various timer systems */
+#define SDL_TIMER_NDS 1
+
+/* Enable various video drivers */
+#define SDL_VIDEO_DRIVER_NDS 1
+#define SDL_VIDEO_DRIVER_DUMMY 1
+
+#endif /* _SDL_config_nds_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_os2.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_os2.h
new file mode 100644
index 000000000..bb40df001
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_os2.h
@@ -0,0 +1,141 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+#ifndef _SDL_config_os2_h
+#define _SDL_config_os2_h
+
+#include "SDL_platform.h"
+
+/* This is a set of defines to configure the SDL features */
+
+typedef signed char int8_t;
+typedef unsigned char uint8_t;
+typedef signed short int16_t;
+typedef unsigned short uint16_t;
+typedef signed int int32_t;
+typedef unsigned int uint32_t;
+typedef unsigned int size_t;
+typedef unsigned long uintptr_t;
+typedef signed long long int64_t;
+typedef unsigned long long uint64_t;
+
+#define SDL_HAS_64BIT_TYPE 1
+
+/* Use Watcom's LIBC */
+#define HAVE_LIBC 1
+
+/* Useful headers */
+#define HAVE_SYS_TYPES_H 1
+#define HAVE_STDIO_H 1
+#define STDC_HEADERS 1
+#define HAVE_STDLIB_H 1
+#define HAVE_STDARG_H 1
+#define HAVE_MALLOC_H 1
+#define HAVE_MEMORY_H 1
+#define HAVE_STRING_H 1
+#define HAVE_STRINGS_H 1
+#define HAVE_INTTYPES_H 1
+#define HAVE_STDINT_H 1
+#define HAVE_CTYPE_H 1
+#define HAVE_MATH_H 1
+#define HAVE_SIGNAL_H 1
+
+/* C library functions */
+#define HAVE_MALLOC 1
+#define HAVE_CALLOC 1
+#define HAVE_REALLOC 1
+#define HAVE_FREE 1
+#define HAVE_ALLOCA 1
+#define HAVE_GETENV 1
+#define HAVE_PUTENV 1
+#define HAVE_UNSETENV 1
+#define HAVE_QSORT 1
+#define HAVE_ABS 1
+#define HAVE_BCOPY 1
+#define HAVE_MEMSET 1
+#define HAVE_MEMCPY 1
+#define HAVE_MEMMOVE 1
+#define HAVE_MEMCMP 1
+#define HAVE_STRLEN 1
+#define HAVE_STRLCPY 1
+#define HAVE_STRLCAT 1
+#define HAVE_STRDUP 1
+#define HAVE__STRREV 1
+#define HAVE__STRUPR 1
+#define HAVE__STRLWR 1
+#define HAVE_INDEX 1
+#define HAVE_RINDEX 1
+#define HAVE_STRCHR 1
+#define HAVE_STRRCHR 1
+#define HAVE_STRSTR 1
+#define HAVE_ITOA 1
+#define HAVE__LTOA 1
+#define HAVE__UITOA 1
+#define HAVE__ULTOA 1
+#define HAVE_STRTOL 1
+#define HAVE__I64TOA 1
+#define HAVE__UI64TOA 1
+#define HAVE_STRTOLL 1
+#define HAVE_STRTOD 1
+#define HAVE_ATOI 1
+#define HAVE_ATOF 1
+#define HAVE_STRCMP 1
+#define HAVE_STRNCMP 1
+#define HAVE_STRICMP 1
+#define HAVE_STRCASECMP 1
+#define HAVE_SSCANF 1
+#define HAVE_SNPRINTF 1
+#define HAVE_VSNPRINTF 1
+#define HAVE_SETJMP 1
+#define HAVE_CLOCK_GETTIME 1
+
+/* Enable various audio drivers */
+#define SDL_AUDIO_DRIVER_DART 1
+#define SDL_AUDIO_DRIVER_DISK 1
+#define SDL_AUDIO_DRIVER_DUMMY 1
+
+/* Enable various cdrom drivers */
+#define SDL_CDROM_OS2 1
+
+/* Enable various input drivers */
+#define SDL_JOYSTICK_OS2 1
+
+/* Enable various shared object loading systems */
+#define SDL_LOADSO_OS2 1
+
+/* Enable various threading systems */
+#define SDL_THREAD_OS2 1
+
+/* Enable various timer systems */
+#define SDL_TIMER_OS2 1
+
+/* Enable various video drivers */
+#define SDL_VIDEO_DRIVER_DUMMY 1
+#define SDL_VIDEO_DRIVER_OS2FS 1
+
+/* Enable OpenGL support */
+/* Nothing here yet for OS/2... :( */
+
+/* Enable assembly routines where available */
+#define SDL_ASSEMBLY_ROUTINES 1
+
+#endif /* _SDL_config_os2_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_symbian.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_symbian.h
new file mode 100644
index 000000000..53527b232
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_symbian.h
@@ -0,0 +1,146 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/*
+
+Symbian version Markus Mertama
+
+*/
+
+
+#ifndef _SDL_CONFIG_SYMBIAN_H
+#define _SDL_CONFIG_SYMBIAN_H
+
+#include "SDL_platform.h"
+
+/* This is the minimal configuration that can be used to build SDL */
+
+
+#include
+#include
+
+
+#ifdef __GCCE__
+#define SYMBIAN32_GCCE
+#endif
+
+#ifndef _SIZE_T_DEFINED
+typedef unsigned int size_t;
+#endif
+
+#ifndef _INTPTR_T_DECLARED
+typedef unsigned int uintptr_t;
+#endif
+
+#ifndef _INT8_T_DECLARED
+typedef signed char int8_t;
+#endif
+
+#ifndef _UINT8_T_DECLARED
+typedef unsigned char uint8_t;
+#endif
+
+#ifndef _INT16_T_DECLARED
+typedef signed short int16_t;
+#endif
+
+#ifndef _UINT16_T_DECLARED
+typedef unsigned short uint16_t;
+#endif
+
+#ifndef _INT32_T_DECLARED
+typedef signed int int32_t;
+#endif
+
+#ifndef _UINT32_T_DECLARED
+typedef unsigned int uint32_t;
+#endif
+
+#ifndef _INT64_T_DECLARED
+typedef signed long long int64_t;
+#endif
+
+#ifndef _UINT64_T_DECLARED
+typedef unsigned long long uint64_t;
+#endif
+
+#define SDL_AUDIO_DRIVER_EPOCAUDIO 1
+
+
+/* Enable the stub cdrom driver (src/cdrom/dummy/\*.c) */
+#define SDL_CDROM_DISABLED 1
+
+/* Enable the stub joystick driver (src/joystick/dummy/\*.c) */
+#define SDL_JOYSTICK_DISABLED 1
+
+/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */
+#define SDL_LOADSO_DISABLED 1
+
+#define SDL_THREAD_SYMBIAN 1
+
+#define SDL_VIDEO_DRIVER_EPOC 1
+
+#define SDL_VIDEO_OPENGL 0
+
+#define SDL_HAS_64BIT_TYPE 1
+
+#define HAVE_LIBC 1
+#define HAVE_STDIO_H 1
+#define STDC_HEADERS 1
+#define HAVE_STRING_H 1
+#define HAVE_CTYPE_H 1
+#define HAVE_MATH_H 1
+
+#define HAVE_MALLOC 1
+#define HAVE_CALLOC 1
+#define HAVE_REALLOC 1
+#define HAVE_FREE 1
+/*#define HAVE_ALLOCA 1*/
+#define HAVE_QSORT 1
+#define HAVE_ABS 1
+#define HAVE_MEMSET 1
+#define HAVE_MEMCPY 1
+#define HAVE_MEMMOVE 1
+#define HAVE_MEMCMP 1
+#define HAVE_STRLEN 1
+#define HAVE__STRUPR 1
+#define HAVE_STRCHR 1
+#define HAVE_STRRCHR 1
+#define HAVE_STRSTR 1
+#define HAVE_ITOA 1
+#define HAVE_STRTOL 1
+#define HAVE_STRTOUL 1
+#define HAVE_STRTOLL 1
+#define HAVE_STRTOD 1
+#define HAVE_ATOI 1
+#define HAVE_ATOF 1
+#define HAVE_STRCMP 1
+#define HAVE_STRNCMP 1
+/*#define HAVE__STRICMP 1*/
+#define HAVE__STRNICMP 1
+#define HAVE_SSCANF 1
+#define HAVE_STDARG_H 1
+#define HAVE_STDDEF_H 1
+
+
+
+#endif /* _SDL_CONFIG_SYMBIAN_H */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_win32.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_win32.h
new file mode 100644
index 000000000..6d019a8d9
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_config_win32.h
@@ -0,0 +1,183 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+#ifndef _SDL_config_win32_h
+#define _SDL_config_win32_h
+
+#include "SDL_platform.h"
+
+/* This is a set of defines to configure the SDL features */
+
+#if defined(__GNUC__) || defined(__DMC__)
+#define HAVE_STDINT_H 1
+#elif defined(_MSC_VER)
+typedef signed __int8 int8_t;
+typedef unsigned __int8 uint8_t;
+typedef signed __int16 int16_t;
+typedef unsigned __int16 uint16_t;
+typedef signed __int32 int32_t;
+typedef unsigned __int32 uint32_t;
+typedef signed __int64 int64_t;
+typedef unsigned __int64 uint64_t;
+#ifndef _UINTPTR_T_DEFINED
+#ifdef _WIN64
+typedef unsigned __int64 uintptr_t;
+#else
+typedef unsigned int uintptr_t;
+#endif
+#define _UINTPTR_T_DEFINED
+#endif
+/* Older Visual C++ headers don't have the Win64-compatible typedefs... */
+#if ((_MSC_VER <= 1200) && (!defined(DWORD_PTR)))
+#define DWORD_PTR DWORD
+#endif
+#if ((_MSC_VER <= 1200) && (!defined(LONG_PTR)))
+#define LONG_PTR LONG
+#endif
+#else /* !__GNUC__ && !_MSC_VER */
+typedef signed char int8_t;
+typedef unsigned char uint8_t;
+typedef signed short int16_t;
+typedef unsigned short uint16_t;
+typedef signed int int32_t;
+typedef unsigned int uint32_t;
+typedef signed long long int64_t;
+typedef unsigned long long uint64_t;
+#ifndef _SIZE_T_DEFINED_
+#define _SIZE_T_DEFINED_
+typedef unsigned int size_t;
+#endif
+typedef unsigned int uintptr_t;
+#endif /* __GNUC__ || _MSC_VER */
+#define SDL_HAS_64BIT_TYPE 1
+
+/* Enabled for SDL 1.2 (binary compatibility) */
+#define HAVE_LIBC 1
+#ifdef HAVE_LIBC
+/* Useful headers */
+#define HAVE_STDIO_H 1
+#define STDC_HEADERS 1
+#define HAVE_STRING_H 1
+#define HAVE_CTYPE_H 1
+#define HAVE_MATH_H 1
+#ifndef _WIN32_WCE
+#define HAVE_SIGNAL_H 1
+#endif
+
+/* C library functions */
+#define HAVE_MALLOC 1
+#define HAVE_CALLOC 1
+#define HAVE_REALLOC 1
+#define HAVE_FREE 1
+#define HAVE_ALLOCA 1
+#define HAVE_QSORT 1
+#define HAVE_ABS 1
+#define HAVE_MEMSET 1
+#define HAVE_MEMCPY 1
+#define HAVE_MEMMOVE 1
+#define HAVE_MEMCMP 1
+#define HAVE_STRLEN 1
+#define HAVE__STRREV 1
+#define HAVE__STRUPR 1
+#define HAVE__STRLWR 1
+#define HAVE_STRCHR 1
+#define HAVE_STRRCHR 1
+#define HAVE_STRSTR 1
+#define HAVE_ITOA 1
+#define HAVE__LTOA 1
+#define HAVE__ULTOA 1
+#define HAVE_STRTOL 1
+#define HAVE_STRTOUL 1
+#define HAVE_STRTOLL 1
+#define HAVE_STRTOD 1
+#define HAVE_ATOI 1
+#define HAVE_ATOF 1
+#define HAVE_STRCMP 1
+#define HAVE_STRNCMP 1
+#define HAVE__STRICMP 1
+#define HAVE__STRNICMP 1
+#define HAVE_SSCANF 1
+#else
+#define HAVE_STDARG_H 1
+#define HAVE_STDDEF_H 1
+#endif
+
+/* Enable various audio drivers */
+#ifndef _WIN32_WCE
+#define SDL_AUDIO_DRIVER_DSOUND 1
+#endif
+#define SDL_AUDIO_DRIVER_WAVEOUT 1
+#define SDL_AUDIO_DRIVER_DISK 1
+#define SDL_AUDIO_DRIVER_DUMMY 1
+
+/* Enable various cdrom drivers */
+#ifdef _WIN32_WCE
+#define SDL_CDROM_DISABLED 1
+#else
+#define SDL_CDROM_WIN32 1
+#endif
+
+/* Enable various input drivers */
+#ifdef _WIN32_WCE
+#define SDL_JOYSTICK_DISABLED 1
+#else
+#define SDL_JOYSTICK_WINMM 1
+#endif
+
+/* Enable various shared object loading systems */
+#define SDL_LOADSO_WIN32 1
+
+/* Enable various threading systems */
+#define SDL_THREAD_WIN32 1
+
+/* Enable various timer systems */
+#ifdef _WIN32_WCE
+#define SDL_TIMER_WINCE 1
+#else
+#define SDL_TIMER_WIN32 1
+#endif
+
+/* Enable various video drivers */
+#ifdef _WIN32_WCE
+#define SDL_VIDEO_DRIVER_GAPI 1
+#endif
+#ifndef _WIN32_WCE
+#define SDL_VIDEO_DRIVER_DDRAW 1
+#endif
+#define SDL_VIDEO_DRIVER_DUMMY 1
+#define SDL_VIDEO_DRIVER_WINDIB 1
+
+/* Enable OpenGL support */
+#ifndef _WIN32_WCE
+#define SDL_VIDEO_OPENGL 1
+#define SDL_VIDEO_OPENGL_WGL 1
+#endif
+
+/* Disable screensaver */
+#define SDL_VIDEO_DISABLE_SCREENSAVER 1
+
+/* Enable assembly routines (Win64 doesn't have inline asm) */
+#ifndef _WIN64
+#define SDL_ASSEMBLY_ROUTINES 1
+#endif
+
+#endif /* _SDL_config_win32_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_copying.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_copying.h
new file mode 100644
index 000000000..1bd6b84cd
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_copying.h
@@ -0,0 +1,22 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_cpuinfo.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_cpuinfo.h
new file mode 100644
index 000000000..f4be8e032
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_cpuinfo.h
@@ -0,0 +1,69 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/**
+ * @file SDL_cpuinfo.h
+ * CPU feature detection for SDL
+ */
+
+#ifndef _SDL_cpuinfo_h
+#define _SDL_cpuinfo_h
+
+#include "SDL_stdinc.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** This function returns true if the CPU has the RDTSC instruction */
+extern DECLSPEC SDL_bool SDLCALL SDL_HasRDTSC(void);
+
+/** This function returns true if the CPU has MMX features */
+extern DECLSPEC SDL_bool SDLCALL SDL_HasMMX(void);
+
+/** This function returns true if the CPU has MMX Ext. features */
+extern DECLSPEC SDL_bool SDLCALL SDL_HasMMXExt(void);
+
+/** This function returns true if the CPU has 3DNow features */
+extern DECLSPEC SDL_bool SDLCALL SDL_Has3DNow(void);
+
+/** This function returns true if the CPU has 3DNow! Ext. features */
+extern DECLSPEC SDL_bool SDLCALL SDL_Has3DNowExt(void);
+
+/** This function returns true if the CPU has SSE features */
+extern DECLSPEC SDL_bool SDLCALL SDL_HasSSE(void);
+
+/** This function returns true if the CPU has SSE2 features */
+extern DECLSPEC SDL_bool SDLCALL SDL_HasSSE2(void);
+
+/** This function returns true if the CPU has AltiVec features */
+extern DECLSPEC SDL_bool SDLCALL SDL_HasAltiVec(void);
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_cpuinfo_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_endian.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_endian.h
new file mode 100644
index 000000000..f7a2e2f8c
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_endian.h
@@ -0,0 +1,209 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/**
+ * @file SDL_endian.h
+ * Functions for reading and writing endian-specific values
+ */
+
+#ifndef _SDL_endian_h
+#define _SDL_endian_h
+
+#include "SDL_stdinc.h"
+
+/** @name SDL_ENDIANs
+ * The two types of endianness
+ */
+/*@{*/
+#define SDL_LIL_ENDIAN 1234
+#define SDL_BIG_ENDIAN 4321
+/*@}*/
+
+#ifndef SDL_BYTEORDER /* Not defined in SDL_config.h? */
+#if defined(__hppa__) || \
+ defined(__m68k__) || defined(mc68000) || defined(_M_M68K) || \
+ (defined(__MIPS__) && defined(__MISPEB__)) || \
+ defined(__ppc__) || defined(__POWERPC__) || defined(_M_PPC) || \
+ defined(__sparc__)
+#define SDL_BYTEORDER SDL_BIG_ENDIAN
+#else
+#define SDL_BYTEORDER SDL_LIL_ENDIAN
+#endif
+#endif /* !SDL_BYTEORDER */
+
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/**
+ * @name SDL_Swap Functions
+ * Use inline functions for compilers that support them, and static
+ * functions for those that do not. Because these functions become
+ * static for compilers that do not support inline functions, this
+ * header should only be included in files that actually use them.
+ */
+/*@{*/
+#if defined(__GNUC__) && defined(__i386__) && \
+ !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */)
+static __inline__ Uint16 SDL_Swap16(Uint16 x)
+{
+ __asm__("xchgb %b0,%h0" : "=q" (x) : "0" (x));
+ return x;
+}
+#elif defined(__GNUC__) && defined(__x86_64__)
+static __inline__ Uint16 SDL_Swap16(Uint16 x)
+{
+ __asm__("xchgb %b0,%h0" : "=Q" (x) : "0" (x));
+ return x;
+}
+#elif defined(__GNUC__) && (defined(__powerpc__) || defined(__ppc__))
+static __inline__ Uint16 SDL_Swap16(Uint16 x)
+{
+ Uint16 result;
+
+ __asm__("rlwimi %0,%2,8,16,23" : "=&r" (result) : "0" (x >> 8), "r" (x));
+ return result;
+}
+#elif defined(__GNUC__) && (defined(__M68000__) || defined(__M68020__))
+static __inline__ Uint16 SDL_Swap16(Uint16 x)
+{
+ __asm__("rorw #8,%0" : "=d" (x) : "0" (x) : "cc");
+ return x;
+}
+#else
+static __inline__ Uint16 SDL_Swap16(Uint16 x) {
+ return((x<<8)|(x>>8));
+}
+#endif
+
+#if defined(__GNUC__) && defined(__i386__) && \
+ !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */)
+static __inline__ Uint32 SDL_Swap32(Uint32 x)
+{
+ __asm__("bswap %0" : "=r" (x) : "0" (x));
+ return x;
+}
+#elif defined(__GNUC__) && defined(__x86_64__)
+static __inline__ Uint32 SDL_Swap32(Uint32 x)
+{
+ __asm__("bswapl %0" : "=r" (x) : "0" (x));
+ return x;
+}
+#elif defined(__GNUC__) && (defined(__powerpc__) || defined(__ppc__))
+static __inline__ Uint32 SDL_Swap32(Uint32 x)
+{
+ Uint32 result;
+
+ __asm__("rlwimi %0,%2,24,16,23" : "=&r" (result) : "0" (x>>24), "r" (x));
+ __asm__("rlwimi %0,%2,8,8,15" : "=&r" (result) : "0" (result), "r" (x));
+ __asm__("rlwimi %0,%2,24,0,7" : "=&r" (result) : "0" (result), "r" (x));
+ return result;
+}
+#elif defined(__GNUC__) && (defined(__M68000__) || defined(__M68020__))
+static __inline__ Uint32 SDL_Swap32(Uint32 x)
+{
+ __asm__("rorw #8,%0\n\tswap %0\n\trorw #8,%0" : "=d" (x) : "0" (x) : "cc");
+ return x;
+}
+#else
+static __inline__ Uint32 SDL_Swap32(Uint32 x) {
+ return((x<<24)|((x<<8)&0x00FF0000)|((x>>8)&0x0000FF00)|(x>>24));
+}
+#endif
+
+#ifdef SDL_HAS_64BIT_TYPE
+#if defined(__GNUC__) && defined(__i386__) && \
+ !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */)
+static __inline__ Uint64 SDL_Swap64(Uint64 x)
+{
+ union {
+ struct { Uint32 a,b; } s;
+ Uint64 u;
+ } v;
+ v.u = x;
+ __asm__("bswapl %0 ; bswapl %1 ; xchgl %0,%1"
+ : "=r" (v.s.a), "=r" (v.s.b)
+ : "0" (v.s.a), "1" (v.s.b));
+ return v.u;
+}
+#elif defined(__GNUC__) && defined(__x86_64__)
+static __inline__ Uint64 SDL_Swap64(Uint64 x)
+{
+ __asm__("bswapq %0" : "=r" (x) : "0" (x));
+ return x;
+}
+#else
+static __inline__ Uint64 SDL_Swap64(Uint64 x)
+{
+ Uint32 hi, lo;
+
+ /* Separate into high and low 32-bit values and swap them */
+ lo = SDL_static_cast(Uint32, x & 0xFFFFFFFF);
+ x >>= 32;
+ hi = SDL_static_cast(Uint32, x & 0xFFFFFFFF);
+ x = SDL_Swap32(lo);
+ x <<= 32;
+ x |= SDL_Swap32(hi);
+ return(x);
+}
+#endif
+#else
+/* This is mainly to keep compilers from complaining in SDL code.
+ * If there is no real 64-bit datatype, then compilers will complain about
+ * the fake 64-bit datatype that SDL provides when it compiles user code.
+ */
+#define SDL_Swap64(X) (X)
+#endif /* SDL_HAS_64BIT_TYPE */
+/*@}*/
+
+/**
+ * @name SDL_SwapLE and SDL_SwapBE Functions
+ * Byteswap item from the specified endianness to the native endianness
+ */
+/*@{*/
+#if SDL_BYTEORDER == SDL_LIL_ENDIAN
+#define SDL_SwapLE16(X) (X)
+#define SDL_SwapLE32(X) (X)
+#define SDL_SwapLE64(X) (X)
+#define SDL_SwapBE16(X) SDL_Swap16(X)
+#define SDL_SwapBE32(X) SDL_Swap32(X)
+#define SDL_SwapBE64(X) SDL_Swap64(X)
+#else
+#define SDL_SwapLE16(X) SDL_Swap16(X)
+#define SDL_SwapLE32(X) SDL_Swap32(X)
+#define SDL_SwapLE64(X) SDL_Swap64(X)
+#define SDL_SwapBE16(X) (X)
+#define SDL_SwapBE32(X) (X)
+#define SDL_SwapBE64(X) (X)
+#endif
+/*@}*/
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_endian_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_error.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_error.h
new file mode 100644
index 000000000..b103703a5
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_error.h
@@ -0,0 +1,72 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/**
+ * @file SDL_error.h
+ * Simple error message routines for SDL
+ */
+
+#ifndef _SDL_error_h
+#define _SDL_error_h
+
+#include "SDL_stdinc.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/**
+ * @name Public functions
+ */
+/*@{*/
+extern DECLSPEC void SDLCALL SDL_SetError(const char *fmt, ...);
+extern DECLSPEC char * SDLCALL SDL_GetError(void);
+extern DECLSPEC void SDLCALL SDL_ClearError(void);
+/*@}*/
+
+/**
+ * @name Private functions
+ * @internal Private error message function - used internally
+ */
+/*@{*/
+#define SDL_OutOfMemory() SDL_Error(SDL_ENOMEM)
+#define SDL_Unsupported() SDL_Error(SDL_UNSUPPORTED)
+typedef enum {
+ SDL_ENOMEM,
+ SDL_EFREAD,
+ SDL_EFWRITE,
+ SDL_EFSEEK,
+ SDL_UNSUPPORTED,
+ SDL_LASTERROR
+} SDL_errorcode;
+extern DECLSPEC void SDLCALL SDL_Error(SDL_errorcode code);
+/*@}*/
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_error_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_events.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_events.h
new file mode 100644
index 000000000..c94a30c9c
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_events.h
@@ -0,0 +1,356 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/**
+ * @file SDL_events.h
+ * Include file for SDL event handling
+ */
+
+#ifndef _SDL_events_h
+#define _SDL_events_h
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+#include "SDL_active.h"
+#include "SDL_keyboard.h"
+#include "SDL_mouse.h"
+#include "SDL_joystick.h"
+#include "SDL_quit.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** @name General keyboard/mouse state definitions */
+/*@{*/
+#define SDL_RELEASED 0
+#define SDL_PRESSED 1
+/*@}*/
+
+/** Event enumerations */
+typedef enum {
+ SDL_NOEVENT = 0, /**< Unused (do not remove) */
+ SDL_ACTIVEEVENT, /**< Application loses/gains visibility */
+ SDL_KEYDOWN, /**< Keys pressed */
+ SDL_KEYUP, /**< Keys released */
+ SDL_MOUSEMOTION, /**< Mouse moved */
+ SDL_MOUSEBUTTONDOWN, /**< Mouse button pressed */
+ SDL_MOUSEBUTTONUP, /**< Mouse button released */
+ SDL_JOYAXISMOTION, /**< Joystick axis motion */
+ SDL_JOYBALLMOTION, /**< Joystick trackball motion */
+ SDL_JOYHATMOTION, /**< Joystick hat position change */
+ SDL_JOYBUTTONDOWN, /**< Joystick button pressed */
+ SDL_JOYBUTTONUP, /**< Joystick button released */
+ SDL_QUIT, /**< User-requested quit */
+ SDL_SYSWMEVENT, /**< System specific event */
+ SDL_EVENT_RESERVEDA, /**< Reserved for future use.. */
+ SDL_EVENT_RESERVEDB, /**< Reserved for future use.. */
+ SDL_VIDEORESIZE, /**< User resized video mode */
+ SDL_VIDEOEXPOSE, /**< Screen needs to be redrawn */
+ SDL_EVENT_RESERVED2, /**< Reserved for future use.. */
+ SDL_EVENT_RESERVED3, /**< Reserved for future use.. */
+ SDL_EVENT_RESERVED4, /**< Reserved for future use.. */
+ SDL_EVENT_RESERVED5, /**< Reserved for future use.. */
+ SDL_EVENT_RESERVED6, /**< Reserved for future use.. */
+ SDL_EVENT_RESERVED7, /**< Reserved for future use.. */
+ /** Events SDL_USEREVENT through SDL_MAXEVENTS-1 are for your use */
+ SDL_USEREVENT = 24,
+ /** This last event is only for bounding internal arrays
+ * It is the number of bits in the event mask datatype -- Uint32
+ */
+ SDL_NUMEVENTS = 32
+} SDL_EventType;
+
+/** @name Predefined event masks */
+/*@{*/
+#define SDL_EVENTMASK(X) (1<<(X))
+typedef enum {
+ SDL_ACTIVEEVENTMASK = SDL_EVENTMASK(SDL_ACTIVEEVENT),
+ SDL_KEYDOWNMASK = SDL_EVENTMASK(SDL_KEYDOWN),
+ SDL_KEYUPMASK = SDL_EVENTMASK(SDL_KEYUP),
+ SDL_KEYEVENTMASK = SDL_EVENTMASK(SDL_KEYDOWN)|
+ SDL_EVENTMASK(SDL_KEYUP),
+ SDL_MOUSEMOTIONMASK = SDL_EVENTMASK(SDL_MOUSEMOTION),
+ SDL_MOUSEBUTTONDOWNMASK = SDL_EVENTMASK(SDL_MOUSEBUTTONDOWN),
+ SDL_MOUSEBUTTONUPMASK = SDL_EVENTMASK(SDL_MOUSEBUTTONUP),
+ SDL_MOUSEEVENTMASK = SDL_EVENTMASK(SDL_MOUSEMOTION)|
+ SDL_EVENTMASK(SDL_MOUSEBUTTONDOWN)|
+ SDL_EVENTMASK(SDL_MOUSEBUTTONUP),
+ SDL_JOYAXISMOTIONMASK = SDL_EVENTMASK(SDL_JOYAXISMOTION),
+ SDL_JOYBALLMOTIONMASK = SDL_EVENTMASK(SDL_JOYBALLMOTION),
+ SDL_JOYHATMOTIONMASK = SDL_EVENTMASK(SDL_JOYHATMOTION),
+ SDL_JOYBUTTONDOWNMASK = SDL_EVENTMASK(SDL_JOYBUTTONDOWN),
+ SDL_JOYBUTTONUPMASK = SDL_EVENTMASK(SDL_JOYBUTTONUP),
+ SDL_JOYEVENTMASK = SDL_EVENTMASK(SDL_JOYAXISMOTION)|
+ SDL_EVENTMASK(SDL_JOYBALLMOTION)|
+ SDL_EVENTMASK(SDL_JOYHATMOTION)|
+ SDL_EVENTMASK(SDL_JOYBUTTONDOWN)|
+ SDL_EVENTMASK(SDL_JOYBUTTONUP),
+ SDL_VIDEORESIZEMASK = SDL_EVENTMASK(SDL_VIDEORESIZE),
+ SDL_VIDEOEXPOSEMASK = SDL_EVENTMASK(SDL_VIDEOEXPOSE),
+ SDL_QUITMASK = SDL_EVENTMASK(SDL_QUIT),
+ SDL_SYSWMEVENTMASK = SDL_EVENTMASK(SDL_SYSWMEVENT)
+} SDL_EventMask ;
+#define SDL_ALLEVENTS 0xFFFFFFFF
+/*@}*/
+
+/** Application visibility event structure */
+typedef struct SDL_ActiveEvent {
+ Uint8 type; /**< SDL_ACTIVEEVENT */
+ Uint8 gain; /**< Whether given states were gained or lost (1/0) */
+ Uint8 state; /**< A mask of the focus states */
+} SDL_ActiveEvent;
+
+/** Keyboard event structure */
+typedef struct SDL_KeyboardEvent {
+ Uint8 type; /**< SDL_KEYDOWN or SDL_KEYUP */
+ Uint8 which; /**< The keyboard device index */
+ Uint8 state; /**< SDL_PRESSED or SDL_RELEASED */
+ SDL_keysym keysym;
+} SDL_KeyboardEvent;
+
+/** Mouse motion event structure */
+typedef struct SDL_MouseMotionEvent {
+ Uint8 type; /**< SDL_MOUSEMOTION */
+ Uint8 which; /**< The mouse device index */
+ Uint8 state; /**< The current button state */
+ Uint16 x, y; /**< The X/Y coordinates of the mouse */
+ Sint16 xrel; /**< The relative motion in the X direction */
+ Sint16 yrel; /**< The relative motion in the Y direction */
+} SDL_MouseMotionEvent;
+
+/** Mouse button event structure */
+typedef struct SDL_MouseButtonEvent {
+ Uint8 type; /**< SDL_MOUSEBUTTONDOWN or SDL_MOUSEBUTTONUP */
+ Uint8 which; /**< The mouse device index */
+ Uint8 button; /**< The mouse button index */
+ Uint8 state; /**< SDL_PRESSED or SDL_RELEASED */
+ Uint16 x, y; /**< The X/Y coordinates of the mouse at press time */
+} SDL_MouseButtonEvent;
+
+/** Joystick axis motion event structure */
+typedef struct SDL_JoyAxisEvent {
+ Uint8 type; /**< SDL_JOYAXISMOTION */
+ Uint8 which; /**< The joystick device index */
+ Uint8 axis; /**< The joystick axis index */
+ Sint16 value; /**< The axis value (range: -32768 to 32767) */
+} SDL_JoyAxisEvent;
+
+/** Joystick trackball motion event structure */
+typedef struct SDL_JoyBallEvent {
+ Uint8 type; /**< SDL_JOYBALLMOTION */
+ Uint8 which; /**< The joystick device index */
+ Uint8 ball; /**< The joystick trackball index */
+ Sint16 xrel; /**< The relative motion in the X direction */
+ Sint16 yrel; /**< The relative motion in the Y direction */
+} SDL_JoyBallEvent;
+
+/** Joystick hat position change event structure */
+typedef struct SDL_JoyHatEvent {
+ Uint8 type; /**< SDL_JOYHATMOTION */
+ Uint8 which; /**< The joystick device index */
+ Uint8 hat; /**< The joystick hat index */
+ Uint8 value; /**< The hat position value:
+ * SDL_HAT_LEFTUP SDL_HAT_UP SDL_HAT_RIGHTUP
+ * SDL_HAT_LEFT SDL_HAT_CENTERED SDL_HAT_RIGHT
+ * SDL_HAT_LEFTDOWN SDL_HAT_DOWN SDL_HAT_RIGHTDOWN
+ * Note that zero means the POV is centered.
+ */
+} SDL_JoyHatEvent;
+
+/** Joystick button event structure */
+typedef struct SDL_JoyButtonEvent {
+ Uint8 type; /**< SDL_JOYBUTTONDOWN or SDL_JOYBUTTONUP */
+ Uint8 which; /**< The joystick device index */
+ Uint8 button; /**< The joystick button index */
+ Uint8 state; /**< SDL_PRESSED or SDL_RELEASED */
+} SDL_JoyButtonEvent;
+
+/** The "window resized" event
+ * When you get this event, you are responsible for setting a new video
+ * mode with the new width and height.
+ */
+typedef struct SDL_ResizeEvent {
+ Uint8 type; /**< SDL_VIDEORESIZE */
+ int w; /**< New width */
+ int h; /**< New height */
+} SDL_ResizeEvent;
+
+/** The "screen redraw" event */
+typedef struct SDL_ExposeEvent {
+ Uint8 type; /**< SDL_VIDEOEXPOSE */
+} SDL_ExposeEvent;
+
+/** The "quit requested" event */
+typedef struct SDL_QuitEvent {
+ Uint8 type; /**< SDL_QUIT */
+} SDL_QuitEvent;
+
+/** A user-defined event type */
+typedef struct SDL_UserEvent {
+ Uint8 type; /**< SDL_USEREVENT through SDL_NUMEVENTS-1 */
+ int code; /**< User defined event code */
+ void *data1; /**< User defined data pointer */
+ void *data2; /**< User defined data pointer */
+} SDL_UserEvent;
+
+/** If you want to use this event, you should include SDL_syswm.h */
+struct SDL_SysWMmsg;
+typedef struct SDL_SysWMmsg SDL_SysWMmsg;
+typedef struct SDL_SysWMEvent {
+ Uint8 type;
+ SDL_SysWMmsg *msg;
+} SDL_SysWMEvent;
+
+/** General event structure */
+typedef union SDL_Event {
+ Uint8 type;
+ SDL_ActiveEvent active;
+ SDL_KeyboardEvent key;
+ SDL_MouseMotionEvent motion;
+ SDL_MouseButtonEvent button;
+ SDL_JoyAxisEvent jaxis;
+ SDL_JoyBallEvent jball;
+ SDL_JoyHatEvent jhat;
+ SDL_JoyButtonEvent jbutton;
+ SDL_ResizeEvent resize;
+ SDL_ExposeEvent expose;
+ SDL_QuitEvent quit;
+ SDL_UserEvent user;
+ SDL_SysWMEvent syswm;
+} SDL_Event;
+
+
+/* Function prototypes */
+
+/** Pumps the event loop, gathering events from the input devices.
+ * This function updates the event queue and internal input device state.
+ * This should only be run in the thread that sets the video mode.
+ */
+extern DECLSPEC void SDLCALL SDL_PumpEvents(void);
+
+typedef enum {
+ SDL_ADDEVENT,
+ SDL_PEEKEVENT,
+ SDL_GETEVENT
+} SDL_eventaction;
+
+/**
+ * Checks the event queue for messages and optionally returns them.
+ *
+ * If 'action' is SDL_ADDEVENT, up to 'numevents' events will be added to
+ * the back of the event queue.
+ * If 'action' is SDL_PEEKEVENT, up to 'numevents' events at the front
+ * of the event queue, matching 'mask', will be returned and will not
+ * be removed from the queue.
+ * If 'action' is SDL_GETEVENT, up to 'numevents' events at the front
+ * of the event queue, matching 'mask', will be returned and will be
+ * removed from the queue.
+ *
+ * @return
+ * This function returns the number of events actually stored, or -1
+ * if there was an error.
+ *
+ * This function is thread-safe.
+ */
+extern DECLSPEC int SDLCALL SDL_PeepEvents(SDL_Event *events, int numevents,
+ SDL_eventaction action, Uint32 mask);
+
+/** Polls for currently pending events, and returns 1 if there are any pending
+ * events, or 0 if there are none available. If 'event' is not NULL, the next
+ * event is removed from the queue and stored in that area.
+ */
+extern DECLSPEC int SDLCALL SDL_PollEvent(SDL_Event *event);
+
+/** Waits indefinitely for the next available event, returning 1, or 0 if there
+ * was an error while waiting for events. If 'event' is not NULL, the next
+ * event is removed from the queue and stored in that area.
+ */
+extern DECLSPEC int SDLCALL SDL_WaitEvent(SDL_Event *event);
+
+/** Add an event to the event queue.
+ * This function returns 0 on success, or -1 if the event queue was full
+ * or there was some other error.
+ */
+extern DECLSPEC int SDLCALL SDL_PushEvent(SDL_Event *event);
+
+/** @name Event Filtering */
+/*@{*/
+typedef int (SDLCALL *SDL_EventFilter)(const SDL_Event *event);
+/**
+ * This function sets up a filter to process all events before they
+ * change internal state and are posted to the internal event queue.
+ *
+ * The filter is protypted as:
+ * @code typedef int (SDLCALL *SDL_EventFilter)(const SDL_Event *event); @endcode
+ *
+ * If the filter returns 1, then the event will be added to the internal queue.
+ * If it returns 0, then the event will be dropped from the queue, but the
+ * internal state will still be updated. This allows selective filtering of
+ * dynamically arriving events.
+ *
+ * @warning Be very careful of what you do in the event filter function, as
+ * it may run in a different thread!
+ *
+ * There is one caveat when dealing with the SDL_QUITEVENT event type. The
+ * event filter is only called when the window manager desires to close the
+ * application window. If the event filter returns 1, then the window will
+ * be closed, otherwise the window will remain open if possible.
+ * If the quit event is generated by an interrupt signal, it will bypass the
+ * internal queue and be delivered to the application at the next event poll.
+ */
+extern DECLSPEC void SDLCALL SDL_SetEventFilter(SDL_EventFilter filter);
+
+/**
+ * Return the current event filter - can be used to "chain" filters.
+ * If there is no event filter set, this function returns NULL.
+ */
+extern DECLSPEC SDL_EventFilter SDLCALL SDL_GetEventFilter(void);
+/*@}*/
+
+/** @name Event State */
+/*@{*/
+#define SDL_QUERY -1
+#define SDL_IGNORE 0
+#define SDL_DISABLE 0
+#define SDL_ENABLE 1
+/*@}*/
+
+/**
+* This function allows you to set the state of processing certain events.
+* If 'state' is set to SDL_IGNORE, that event will be automatically dropped
+* from the event queue and will not event be filtered.
+* If 'state' is set to SDL_ENABLE, that event will be processed normally.
+* If 'state' is set to SDL_QUERY, SDL_EventState() will return the
+* current processing state of the specified event.
+*/
+extern DECLSPEC Uint8 SDLCALL SDL_EventState(Uint8 type, int state);
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_events_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_getenv.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_getenv.h
new file mode 100644
index 000000000..253ad88cc
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_getenv.h
@@ -0,0 +1,28 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_getenv.h
+ * @deprecated Use SDL_stdinc.h instead
+ */
+
+/* DEPRECATED */
+#include "SDL_stdinc.h"
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_joystick.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_joystick.h
new file mode 100644
index 000000000..d5135c3d5
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_joystick.h
@@ -0,0 +1,187 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_joystick.h
+ * Include file for SDL joystick event handling
+ */
+
+#ifndef _SDL_joystick_h
+#define _SDL_joystick_h
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** @file SDL_joystick.h
+ * @note In order to use these functions, SDL_Init() must have been called
+ * with the SDL_INIT_JOYSTICK flag. This causes SDL to scan the system
+ * for joysticks, and load appropriate drivers.
+ */
+
+/** The joystick structure used to identify an SDL joystick */
+struct _SDL_Joystick;
+typedef struct _SDL_Joystick SDL_Joystick;
+
+/* Function prototypes */
+/**
+ * Count the number of joysticks attached to the system
+ */
+extern DECLSPEC int SDLCALL SDL_NumJoysticks(void);
+
+/**
+ * Get the implementation dependent name of a joystick.
+ *
+ * This can be called before any joysticks are opened.
+ * If no name can be found, this function returns NULL.
+ */
+extern DECLSPEC const char * SDLCALL SDL_JoystickName(int device_index);
+
+/**
+ * Open a joystick for use.
+ *
+ * @param[in] device_index
+ * The index passed as an argument refers to
+ * the N'th joystick on the system. This index is the value which will
+ * identify this joystick in future joystick events.
+ *
+ * @return This function returns a joystick identifier, or NULL if an error occurred.
+ */
+extern DECLSPEC SDL_Joystick * SDLCALL SDL_JoystickOpen(int device_index);
+
+/**
+ * Returns 1 if the joystick has been opened, or 0 if it has not.
+ */
+extern DECLSPEC int SDLCALL SDL_JoystickOpened(int device_index);
+
+/**
+ * Get the device index of an opened joystick.
+ */
+extern DECLSPEC int SDLCALL SDL_JoystickIndex(SDL_Joystick *joystick);
+
+/**
+ * Get the number of general axis controls on a joystick
+ */
+extern DECLSPEC int SDLCALL SDL_JoystickNumAxes(SDL_Joystick *joystick);
+
+/**
+ * Get the number of trackballs on a joystick
+ *
+ * Joystick trackballs have only relative motion events associated
+ * with them and their state cannot be polled.
+ */
+extern DECLSPEC int SDLCALL SDL_JoystickNumBalls(SDL_Joystick *joystick);
+
+/**
+ * Get the number of POV hats on a joystick
+ */
+extern DECLSPEC int SDLCALL SDL_JoystickNumHats(SDL_Joystick *joystick);
+
+/**
+ * Get the number of buttons on a joystick
+ */
+extern DECLSPEC int SDLCALL SDL_JoystickNumButtons(SDL_Joystick *joystick);
+
+/**
+ * Update the current state of the open joysticks.
+ *
+ * This is called automatically by the event loop if any joystick
+ * events are enabled.
+ */
+extern DECLSPEC void SDLCALL SDL_JoystickUpdate(void);
+
+/**
+ * Enable/disable joystick event polling.
+ *
+ * If joystick events are disabled, you must call SDL_JoystickUpdate()
+ * yourself and check the state of the joystick when you want joystick
+ * information.
+ *
+ * @param[in] state The state can be one of SDL_QUERY, SDL_ENABLE or SDL_IGNORE.
+ */
+extern DECLSPEC int SDLCALL SDL_JoystickEventState(int state);
+
+/**
+ * Get the current state of an axis control on a joystick
+ *
+ * @param[in] axis The axis indices start at index 0.
+ *
+ * @return The state is a value ranging from -32768 to 32767.
+ */
+extern DECLSPEC Sint16 SDLCALL SDL_JoystickGetAxis(SDL_Joystick *joystick, int axis);
+
+/**
+ * @name Hat Positions
+ * The return value of SDL_JoystickGetHat() is one of the following positions:
+ */
+/*@{*/
+#define SDL_HAT_CENTERED 0x00
+#define SDL_HAT_UP 0x01
+#define SDL_HAT_RIGHT 0x02
+#define SDL_HAT_DOWN 0x04
+#define SDL_HAT_LEFT 0x08
+#define SDL_HAT_RIGHTUP (SDL_HAT_RIGHT|SDL_HAT_UP)
+#define SDL_HAT_RIGHTDOWN (SDL_HAT_RIGHT|SDL_HAT_DOWN)
+#define SDL_HAT_LEFTUP (SDL_HAT_LEFT|SDL_HAT_UP)
+#define SDL_HAT_LEFTDOWN (SDL_HAT_LEFT|SDL_HAT_DOWN)
+/*@}*/
+
+/**
+ * Get the current state of a POV hat on a joystick
+ *
+ * @param[in] hat The hat indices start at index 0.
+ */
+extern DECLSPEC Uint8 SDLCALL SDL_JoystickGetHat(SDL_Joystick *joystick, int hat);
+
+/**
+ * Get the ball axis change since the last poll
+ *
+ * @param[in] ball The ball indices start at index 0.
+ *
+ * @return This returns 0, or -1 if you passed it invalid parameters.
+ */
+extern DECLSPEC int SDLCALL SDL_JoystickGetBall(SDL_Joystick *joystick, int ball, int *dx, int *dy);
+
+/**
+ * Get the current state of a button on a joystick
+ *
+ * @param[in] button The button indices start at index 0.
+ */
+extern DECLSPEC Uint8 SDLCALL SDL_JoystickGetButton(SDL_Joystick *joystick, int button);
+
+/**
+ * Close a joystick previously opened with SDL_JoystickOpen()
+ */
+extern DECLSPEC void SDLCALL SDL_JoystickClose(SDL_Joystick *joystick);
+
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_joystick_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_keyboard.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_keyboard.h
new file mode 100644
index 000000000..7b59d24e5
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_keyboard.h
@@ -0,0 +1,135 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_keyboard.h
+ * Include file for SDL keyboard event handling
+ */
+
+#ifndef _SDL_keyboard_h
+#define _SDL_keyboard_h
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+#include "SDL_keysym.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** Keysym structure
+ *
+ * - The scancode is hardware dependent, and should not be used by general
+ * applications. If no hardware scancode is available, it will be 0.
+ *
+ * - The 'unicode' translated character is only available when character
+ * translation is enabled by the SDL_EnableUNICODE() API. If non-zero,
+ * this is a UNICODE character corresponding to the keypress. If the
+ * high 9 bits of the character are 0, then this maps to the equivalent
+ * ASCII character:
+ * @code
+ * char ch;
+ * if ( (keysym.unicode & 0xFF80) == 0 ) {
+ * ch = keysym.unicode & 0x7F;
+ * } else {
+ * An international character..
+ * }
+ * @endcode
+ */
+typedef struct SDL_keysym {
+ Uint8 scancode; /**< hardware specific scancode */
+ SDLKey sym; /**< SDL virtual keysym */
+ SDLMod mod; /**< current key modifiers */
+ Uint16 unicode; /**< translated character */
+} SDL_keysym;
+
+/** This is the mask which refers to all hotkey bindings */
+#define SDL_ALL_HOTKEYS 0xFFFFFFFF
+
+/* Function prototypes */
+/**
+ * Enable/Disable UNICODE translation of keyboard input.
+ *
+ * This translation has some overhead, so translation defaults off.
+ *
+ * @param[in] enable
+ * If 'enable' is 1, translation is enabled.
+ * If 'enable' is 0, translation is disabled.
+ * If 'enable' is -1, the translation state is not changed.
+ *
+ * @return It returns the previous state of keyboard translation.
+ */
+extern DECLSPEC int SDLCALL SDL_EnableUNICODE(int enable);
+
+#define SDL_DEFAULT_REPEAT_DELAY 500
+#define SDL_DEFAULT_REPEAT_INTERVAL 30
+/**
+ * Enable/Disable keyboard repeat. Keyboard repeat defaults to off.
+ *
+ * @param[in] delay
+ * 'delay' is the initial delay in ms between the time when a key is
+ * pressed, and keyboard repeat begins.
+ *
+ * @param[in] interval
+ * 'interval' is the time in ms between keyboard repeat events.
+ *
+ * If 'delay' is set to 0, keyboard repeat is disabled.
+ */
+extern DECLSPEC int SDLCALL SDL_EnableKeyRepeat(int delay, int interval);
+extern DECLSPEC void SDLCALL SDL_GetKeyRepeat(int *delay, int *interval);
+
+/**
+ * Get a snapshot of the current state of the keyboard.
+ * Returns an array of keystates, indexed by the SDLK_* syms.
+ * Usage:
+ * @code
+ * Uint8 *keystate = SDL_GetKeyState(NULL);
+ * if ( keystate[SDLK_RETURN] ) //... \ is pressed.
+ * @endcode
+ */
+extern DECLSPEC Uint8 * SDLCALL SDL_GetKeyState(int *numkeys);
+
+/**
+ * Get the current key modifier state
+ */
+extern DECLSPEC SDLMod SDLCALL SDL_GetModState(void);
+
+/**
+ * Set the current key modifier state.
+ * This does not change the keyboard state, only the key modifier flags.
+ */
+extern DECLSPEC void SDLCALL SDL_SetModState(SDLMod modstate);
+
+/**
+ * Get the name of an SDL virtual keysym
+ */
+extern DECLSPEC char * SDLCALL SDL_GetKeyName(SDLKey key);
+
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_keyboard_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_keysym.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_keysym.h
new file mode 100644
index 000000000..90101286e
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_keysym.h
@@ -0,0 +1,326 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+#ifndef _SDL_keysym_h
+#define _SDL_keysym_h
+
+/** What we really want is a mapping of every raw key on the keyboard.
+ * To support international keyboards, we use the range 0xA1 - 0xFF
+ * as international virtual keycodes. We'll follow in the footsteps of X11...
+ * @brief The names of the keys
+ */
+typedef enum {
+ /** @name ASCII mapped keysyms
+ * The keyboard syms have been cleverly chosen to map to ASCII
+ */
+ /*@{*/
+ SDLK_UNKNOWN = 0,
+ SDLK_FIRST = 0,
+ SDLK_BACKSPACE = 8,
+ SDLK_TAB = 9,
+ SDLK_CLEAR = 12,
+ SDLK_RETURN = 13,
+ SDLK_PAUSE = 19,
+ SDLK_ESCAPE = 27,
+ SDLK_SPACE = 32,
+ SDLK_EXCLAIM = 33,
+ SDLK_QUOTEDBL = 34,
+ SDLK_HASH = 35,
+ SDLK_DOLLAR = 36,
+ SDLK_AMPERSAND = 38,
+ SDLK_QUOTE = 39,
+ SDLK_LEFTPAREN = 40,
+ SDLK_RIGHTPAREN = 41,
+ SDLK_ASTERISK = 42,
+ SDLK_PLUS = 43,
+ SDLK_COMMA = 44,
+ SDLK_MINUS = 45,
+ SDLK_PERIOD = 46,
+ SDLK_SLASH = 47,
+ SDLK_0 = 48,
+ SDLK_1 = 49,
+ SDLK_2 = 50,
+ SDLK_3 = 51,
+ SDLK_4 = 52,
+ SDLK_5 = 53,
+ SDLK_6 = 54,
+ SDLK_7 = 55,
+ SDLK_8 = 56,
+ SDLK_9 = 57,
+ SDLK_COLON = 58,
+ SDLK_SEMICOLON = 59,
+ SDLK_LESS = 60,
+ SDLK_EQUALS = 61,
+ SDLK_GREATER = 62,
+ SDLK_QUESTION = 63,
+ SDLK_AT = 64,
+ /*
+ Skip uppercase letters
+ */
+ SDLK_LEFTBRACKET = 91,
+ SDLK_BACKSLASH = 92,
+ SDLK_RIGHTBRACKET = 93,
+ SDLK_CARET = 94,
+ SDLK_UNDERSCORE = 95,
+ SDLK_BACKQUOTE = 96,
+ SDLK_a = 97,
+ SDLK_b = 98,
+ SDLK_c = 99,
+ SDLK_d = 100,
+ SDLK_e = 101,
+ SDLK_f = 102,
+ SDLK_g = 103,
+ SDLK_h = 104,
+ SDLK_i = 105,
+ SDLK_j = 106,
+ SDLK_k = 107,
+ SDLK_l = 108,
+ SDLK_m = 109,
+ SDLK_n = 110,
+ SDLK_o = 111,
+ SDLK_p = 112,
+ SDLK_q = 113,
+ SDLK_r = 114,
+ SDLK_s = 115,
+ SDLK_t = 116,
+ SDLK_u = 117,
+ SDLK_v = 118,
+ SDLK_w = 119,
+ SDLK_x = 120,
+ SDLK_y = 121,
+ SDLK_z = 122,
+ SDLK_DELETE = 127,
+ /* End of ASCII mapped keysyms */
+ /*@}*/
+
+ /** @name International keyboard syms */
+ /*@{*/
+ SDLK_WORLD_0 = 160, /* 0xA0 */
+ SDLK_WORLD_1 = 161,
+ SDLK_WORLD_2 = 162,
+ SDLK_WORLD_3 = 163,
+ SDLK_WORLD_4 = 164,
+ SDLK_WORLD_5 = 165,
+ SDLK_WORLD_6 = 166,
+ SDLK_WORLD_7 = 167,
+ SDLK_WORLD_8 = 168,
+ SDLK_WORLD_9 = 169,
+ SDLK_WORLD_10 = 170,
+ SDLK_WORLD_11 = 171,
+ SDLK_WORLD_12 = 172,
+ SDLK_WORLD_13 = 173,
+ SDLK_WORLD_14 = 174,
+ SDLK_WORLD_15 = 175,
+ SDLK_WORLD_16 = 176,
+ SDLK_WORLD_17 = 177,
+ SDLK_WORLD_18 = 178,
+ SDLK_WORLD_19 = 179,
+ SDLK_WORLD_20 = 180,
+ SDLK_WORLD_21 = 181,
+ SDLK_WORLD_22 = 182,
+ SDLK_WORLD_23 = 183,
+ SDLK_WORLD_24 = 184,
+ SDLK_WORLD_25 = 185,
+ SDLK_WORLD_26 = 186,
+ SDLK_WORLD_27 = 187,
+ SDLK_WORLD_28 = 188,
+ SDLK_WORLD_29 = 189,
+ SDLK_WORLD_30 = 190,
+ SDLK_WORLD_31 = 191,
+ SDLK_WORLD_32 = 192,
+ SDLK_WORLD_33 = 193,
+ SDLK_WORLD_34 = 194,
+ SDLK_WORLD_35 = 195,
+ SDLK_WORLD_36 = 196,
+ SDLK_WORLD_37 = 197,
+ SDLK_WORLD_38 = 198,
+ SDLK_WORLD_39 = 199,
+ SDLK_WORLD_40 = 200,
+ SDLK_WORLD_41 = 201,
+ SDLK_WORLD_42 = 202,
+ SDLK_WORLD_43 = 203,
+ SDLK_WORLD_44 = 204,
+ SDLK_WORLD_45 = 205,
+ SDLK_WORLD_46 = 206,
+ SDLK_WORLD_47 = 207,
+ SDLK_WORLD_48 = 208,
+ SDLK_WORLD_49 = 209,
+ SDLK_WORLD_50 = 210,
+ SDLK_WORLD_51 = 211,
+ SDLK_WORLD_52 = 212,
+ SDLK_WORLD_53 = 213,
+ SDLK_WORLD_54 = 214,
+ SDLK_WORLD_55 = 215,
+ SDLK_WORLD_56 = 216,
+ SDLK_WORLD_57 = 217,
+ SDLK_WORLD_58 = 218,
+ SDLK_WORLD_59 = 219,
+ SDLK_WORLD_60 = 220,
+ SDLK_WORLD_61 = 221,
+ SDLK_WORLD_62 = 222,
+ SDLK_WORLD_63 = 223,
+ SDLK_WORLD_64 = 224,
+ SDLK_WORLD_65 = 225,
+ SDLK_WORLD_66 = 226,
+ SDLK_WORLD_67 = 227,
+ SDLK_WORLD_68 = 228,
+ SDLK_WORLD_69 = 229,
+ SDLK_WORLD_70 = 230,
+ SDLK_WORLD_71 = 231,
+ SDLK_WORLD_72 = 232,
+ SDLK_WORLD_73 = 233,
+ SDLK_WORLD_74 = 234,
+ SDLK_WORLD_75 = 235,
+ SDLK_WORLD_76 = 236,
+ SDLK_WORLD_77 = 237,
+ SDLK_WORLD_78 = 238,
+ SDLK_WORLD_79 = 239,
+ SDLK_WORLD_80 = 240,
+ SDLK_WORLD_81 = 241,
+ SDLK_WORLD_82 = 242,
+ SDLK_WORLD_83 = 243,
+ SDLK_WORLD_84 = 244,
+ SDLK_WORLD_85 = 245,
+ SDLK_WORLD_86 = 246,
+ SDLK_WORLD_87 = 247,
+ SDLK_WORLD_88 = 248,
+ SDLK_WORLD_89 = 249,
+ SDLK_WORLD_90 = 250,
+ SDLK_WORLD_91 = 251,
+ SDLK_WORLD_92 = 252,
+ SDLK_WORLD_93 = 253,
+ SDLK_WORLD_94 = 254,
+ SDLK_WORLD_95 = 255, /* 0xFF */
+ /*@}*/
+
+ /** @name Numeric keypad */
+ /*@{*/
+ SDLK_KP0 = 256,
+ SDLK_KP1 = 257,
+ SDLK_KP2 = 258,
+ SDLK_KP3 = 259,
+ SDLK_KP4 = 260,
+ SDLK_KP5 = 261,
+ SDLK_KP6 = 262,
+ SDLK_KP7 = 263,
+ SDLK_KP8 = 264,
+ SDLK_KP9 = 265,
+ SDLK_KP_PERIOD = 266,
+ SDLK_KP_DIVIDE = 267,
+ SDLK_KP_MULTIPLY = 268,
+ SDLK_KP_MINUS = 269,
+ SDLK_KP_PLUS = 270,
+ SDLK_KP_ENTER = 271,
+ SDLK_KP_EQUALS = 272,
+ /*@}*/
+
+ /** @name Arrows + Home/End pad */
+ /*@{*/
+ SDLK_UP = 273,
+ SDLK_DOWN = 274,
+ SDLK_RIGHT = 275,
+ SDLK_LEFT = 276,
+ SDLK_INSERT = 277,
+ SDLK_HOME = 278,
+ SDLK_END = 279,
+ SDLK_PAGEUP = 280,
+ SDLK_PAGEDOWN = 281,
+ /*@}*/
+
+ /** @name Function keys */
+ /*@{*/
+ SDLK_F1 = 282,
+ SDLK_F2 = 283,
+ SDLK_F3 = 284,
+ SDLK_F4 = 285,
+ SDLK_F5 = 286,
+ SDLK_F6 = 287,
+ SDLK_F7 = 288,
+ SDLK_F8 = 289,
+ SDLK_F9 = 290,
+ SDLK_F10 = 291,
+ SDLK_F11 = 292,
+ SDLK_F12 = 293,
+ SDLK_F13 = 294,
+ SDLK_F14 = 295,
+ SDLK_F15 = 296,
+ /*@}*/
+
+ /** @name Key state modifier keys */
+ /*@{*/
+ SDLK_NUMLOCK = 300,
+ SDLK_CAPSLOCK = 301,
+ SDLK_SCROLLOCK = 302,
+ SDLK_RSHIFT = 303,
+ SDLK_LSHIFT = 304,
+ SDLK_RCTRL = 305,
+ SDLK_LCTRL = 306,
+ SDLK_RALT = 307,
+ SDLK_LALT = 308,
+ SDLK_RMETA = 309,
+ SDLK_LMETA = 310,
+ SDLK_LSUPER = 311, /**< Left "Windows" key */
+ SDLK_RSUPER = 312, /**< Right "Windows" key */
+ SDLK_MODE = 313, /**< "Alt Gr" key */
+ SDLK_COMPOSE = 314, /**< Multi-key compose key */
+ /*@}*/
+
+ /** @name Miscellaneous function keys */
+ /*@{*/
+ SDLK_HELP = 315,
+ SDLK_PRINT = 316,
+ SDLK_SYSREQ = 317,
+ SDLK_BREAK = 318,
+ SDLK_MENU = 319,
+ SDLK_POWER = 320, /**< Power Macintosh power key */
+ SDLK_EURO = 321, /**< Some european keyboards */
+ SDLK_UNDO = 322, /**< Atari keyboard has Undo */
+ /*@}*/
+
+ /* Add any other keys here */
+
+ SDLK_LAST
+} SDLKey;
+
+/** Enumeration of valid key mods (possibly OR'd together) */
+typedef enum {
+ KMOD_NONE = 0x0000,
+ KMOD_LSHIFT= 0x0001,
+ KMOD_RSHIFT= 0x0002,
+ KMOD_LCTRL = 0x0040,
+ KMOD_RCTRL = 0x0080,
+ KMOD_LALT = 0x0100,
+ KMOD_RALT = 0x0200,
+ KMOD_LMETA = 0x0400,
+ KMOD_RMETA = 0x0800,
+ KMOD_NUM = 0x1000,
+ KMOD_CAPS = 0x2000,
+ KMOD_MODE = 0x4000,
+ KMOD_RESERVED = 0x8000
+} SDLMod;
+
+#define KMOD_CTRL (KMOD_LCTRL|KMOD_RCTRL)
+#define KMOD_SHIFT (KMOD_LSHIFT|KMOD_RSHIFT)
+#define KMOD_ALT (KMOD_LALT|KMOD_RALT)
+#define KMOD_META (KMOD_LMETA|KMOD_RMETA)
+
+#endif /* _SDL_keysym_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_loadso.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_loadso.h
new file mode 100644
index 000000000..45a17f9f4
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_loadso.h
@@ -0,0 +1,78 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_loadso.h
+ * System dependent library loading routines
+ */
+
+/** @file SDL_loadso.h
+ * Some things to keep in mind:
+ * - These functions only work on C function names. Other languages may
+ * have name mangling and intrinsic language support that varies from
+ * compiler to compiler.
+ * - Make sure you declare your function pointers with the same calling
+ * convention as the actual library function. Your code will crash
+ * mysteriously if you do not do this.
+ * - Avoid namespace collisions. If you load a symbol from the library,
+ * it is not defined whether or not it goes into the global symbol
+ * namespace for the application. If it does and it conflicts with
+ * symbols in your code or other shared libraries, you will not get
+ * the results you expect. :)
+ */
+
+
+#ifndef _SDL_loadso_h
+#define _SDL_loadso_h
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/**
+ * This function dynamically loads a shared object and returns a pointer
+ * to the object handle (or NULL if there was an error).
+ * The 'sofile' parameter is a system dependent name of the object file.
+ */
+extern DECLSPEC void * SDLCALL SDL_LoadObject(const char *sofile);
+
+/**
+ * Given an object handle, this function looks up the address of the
+ * named function in the shared object and returns it. This address
+ * is no longer valid after calling SDL_UnloadObject().
+ */
+extern DECLSPEC void * SDLCALL SDL_LoadFunction(void *handle, const char *name);
+
+/** Unload a shared object from memory */
+extern DECLSPEC void SDLCALL SDL_UnloadObject(void *handle);
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_loadso_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_main.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_main.h
new file mode 100644
index 000000000..b7f6b2c82
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_main.h
@@ -0,0 +1,106 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+#ifndef _SDL_main_h
+#define _SDL_main_h
+
+#include "SDL_stdinc.h"
+
+/** @file SDL_main.h
+ * Redefine main() on Win32 and MacOS so that it is called by winmain.c
+ */
+
+#if defined(__WIN32__) || \
+ (defined(__MWERKS__) && !defined(__BEOS__)) || \
+ defined(__MACOS__) || defined(__MACOSX__) || \
+ defined(__SYMBIAN32__) || defined(QWS)
+
+#ifdef __cplusplus
+#define C_LINKAGE "C"
+#else
+#define C_LINKAGE
+#endif /* __cplusplus */
+
+/** The application's main() function must be called with C linkage,
+ * and should be declared like this:
+ * @code
+ * #ifdef __cplusplus
+ * extern "C"
+ * #endif
+ * int main(int argc, char *argv[])
+ * {
+ * }
+ * @endcode
+ */
+#define main SDL_main
+
+/** The prototype for the application's main() function */
+extern C_LINKAGE int SDL_main(int argc, char *argv[]);
+
+
+/** @name From the SDL library code -- needed for registering the app on Win32 */
+/*@{*/
+#ifdef __WIN32__
+
+#include "begin_code.h"
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** This should be called from your WinMain() function, if any */
+extern DECLSPEC void SDLCALL SDL_SetModuleHandle(void *hInst);
+/** This can also be called, but is no longer necessary */
+extern DECLSPEC int SDLCALL SDL_RegisterApp(char *name, Uint32 style, void *hInst);
+/** This can also be called, but is no longer necessary (SDL_Quit calls it) */
+extern DECLSPEC void SDLCALL SDL_UnregisterApp(void);
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+#endif
+/*@}*/
+
+/** @name From the SDL library code -- needed for registering QuickDraw on MacOS */
+/*@{*/
+#if defined(__MACOS__)
+
+#include "begin_code.h"
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** Forward declaration so we don't need to include QuickDraw.h */
+struct QDGlobals;
+
+/** This should be called from your main() function, if any */
+extern DECLSPEC void SDLCALL SDL_InitQuickDraw(struct QDGlobals *the_qd);
+
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+#endif
+/*@}*/
+
+#endif /* Need to redefine main()? */
+
+#endif /* _SDL_main_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_mouse.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_mouse.h
new file mode 100644
index 000000000..a573f04ee
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_mouse.h
@@ -0,0 +1,143 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_mouse.h
+ * Include file for SDL mouse event handling
+ */
+
+#ifndef _SDL_mouse_h
+#define _SDL_mouse_h
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+#include "SDL_video.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+typedef struct WMcursor WMcursor; /**< Implementation dependent */
+typedef struct SDL_Cursor {
+ SDL_Rect area; /**< The area of the mouse cursor */
+ Sint16 hot_x, hot_y; /**< The "tip" of the cursor */
+ Uint8 *data; /**< B/W cursor data */
+ Uint8 *mask; /**< B/W cursor mask */
+ Uint8 *save[2]; /**< Place to save cursor area */
+ WMcursor *wm_cursor; /**< Window-manager cursor */
+} SDL_Cursor;
+
+/* Function prototypes */
+/**
+ * Retrieve the current state of the mouse.
+ * The current button state is returned as a button bitmask, which can
+ * be tested using the SDL_BUTTON(X) macros, and x and y are set to the
+ * current mouse cursor position. You can pass NULL for either x or y.
+ */
+extern DECLSPEC Uint8 SDLCALL SDL_GetMouseState(int *x, int *y);
+
+/**
+ * Retrieve the current state of the mouse.
+ * The current button state is returned as a button bitmask, which can
+ * be tested using the SDL_BUTTON(X) macros, and x and y are set to the
+ * mouse deltas since the last call to SDL_GetRelativeMouseState().
+ */
+extern DECLSPEC Uint8 SDLCALL SDL_GetRelativeMouseState(int *x, int *y);
+
+/**
+ * Set the position of the mouse cursor (generates a mouse motion event)
+ */
+extern DECLSPEC void SDLCALL SDL_WarpMouse(Uint16 x, Uint16 y);
+
+/**
+ * Create a cursor using the specified data and mask (in MSB format).
+ * The cursor width must be a multiple of 8 bits.
+ *
+ * The cursor is created in black and white according to the following:
+ * data mask resulting pixel on screen
+ * 0 1 White
+ * 1 1 Black
+ * 0 0 Transparent
+ * 1 0 Inverted color if possible, black if not.
+ *
+ * Cursors created with this function must be freed with SDL_FreeCursor().
+ */
+extern DECLSPEC SDL_Cursor * SDLCALL SDL_CreateCursor
+ (Uint8 *data, Uint8 *mask, int w, int h, int hot_x, int hot_y);
+
+/**
+ * Set the currently active cursor to the specified one.
+ * If the cursor is currently visible, the change will be immediately
+ * represented on the display.
+ */
+extern DECLSPEC void SDLCALL SDL_SetCursor(SDL_Cursor *cursor);
+
+/**
+ * Returns the currently active cursor.
+ */
+extern DECLSPEC SDL_Cursor * SDLCALL SDL_GetCursor(void);
+
+/**
+ * Deallocates a cursor created with SDL_CreateCursor().
+ */
+extern DECLSPEC void SDLCALL SDL_FreeCursor(SDL_Cursor *cursor);
+
+/**
+ * Toggle whether or not the cursor is shown on the screen.
+ * The cursor start off displayed, but can be turned off.
+ * SDL_ShowCursor() returns 1 if the cursor was being displayed
+ * before the call, or 0 if it was not. You can query the current
+ * state by passing a 'toggle' value of -1.
+ */
+extern DECLSPEC int SDLCALL SDL_ShowCursor(int toggle);
+
+/*@{*/
+/** Used as a mask when testing buttons in buttonstate
+ * Button 1: Left mouse button
+ * Button 2: Middle mouse button
+ * Button 3: Right mouse button
+ * Button 4: Mouse wheel up (may also be a real button)
+ * Button 5: Mouse wheel down (may also be a real button)
+ */
+#define SDL_BUTTON(X) (1 << ((X)-1))
+#define SDL_BUTTON_LEFT 1
+#define SDL_BUTTON_MIDDLE 2
+#define SDL_BUTTON_RIGHT 3
+#define SDL_BUTTON_WHEELUP 4
+#define SDL_BUTTON_WHEELDOWN 5
+#define SDL_BUTTON_X1 6
+#define SDL_BUTTON_X2 7
+#define SDL_BUTTON_LMASK SDL_BUTTON(SDL_BUTTON_LEFT)
+#define SDL_BUTTON_MMASK SDL_BUTTON(SDL_BUTTON_MIDDLE)
+#define SDL_BUTTON_RMASK SDL_BUTTON(SDL_BUTTON_RIGHT)
+#define SDL_BUTTON_X1MASK SDL_BUTTON(SDL_BUTTON_X1)
+#define SDL_BUTTON_X2MASK SDL_BUTTON(SDL_BUTTON_X2)
+/*@}*/
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_mouse_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_mutex.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_mutex.h
new file mode 100644
index 000000000..920971dfa
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_mutex.h
@@ -0,0 +1,177 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+#ifndef _SDL_mutex_h
+#define _SDL_mutex_h
+
+/** @file SDL_mutex.h
+ * Functions to provide thread synchronization primitives
+ *
+ * @note These are independent of the other SDL routines.
+ */
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** Synchronization functions which can time out return this value
+ * if they time out.
+ */
+#define SDL_MUTEX_TIMEDOUT 1
+
+/** This is the timeout value which corresponds to never time out */
+#define SDL_MUTEX_MAXWAIT (~(Uint32)0)
+
+
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+/** @name Mutex functions */ /*@{*/
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+
+/** The SDL mutex structure, defined in SDL_mutex.c */
+struct SDL_mutex;
+typedef struct SDL_mutex SDL_mutex;
+
+/** Create a mutex, initialized unlocked */
+extern DECLSPEC SDL_mutex * SDLCALL SDL_CreateMutex(void);
+
+#define SDL_LockMutex(m) SDL_mutexP(m)
+/** Lock the mutex
+ * @return 0, or -1 on error
+ */
+extern DECLSPEC int SDLCALL SDL_mutexP(SDL_mutex *mutex);
+
+#define SDL_UnlockMutex(m) SDL_mutexV(m)
+/** Unlock the mutex
+ * @return 0, or -1 on error
+ *
+ * It is an error to unlock a mutex that has not been locked by
+ * the current thread, and doing so results in undefined behavior.
+ */
+extern DECLSPEC int SDLCALL SDL_mutexV(SDL_mutex *mutex);
+
+/** Destroy a mutex */
+extern DECLSPEC void SDLCALL SDL_DestroyMutex(SDL_mutex *mutex);
+
+/*@}*/
+
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+/** @name Semaphore functions */ /*@{*/
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+
+/** The SDL semaphore structure, defined in SDL_sem.c */
+struct SDL_semaphore;
+typedef struct SDL_semaphore SDL_sem;
+
+/** Create a semaphore, initialized with value, returns NULL on failure. */
+extern DECLSPEC SDL_sem * SDLCALL SDL_CreateSemaphore(Uint32 initial_value);
+
+/** Destroy a semaphore */
+extern DECLSPEC void SDLCALL SDL_DestroySemaphore(SDL_sem *sem);
+
+/**
+ * This function suspends the calling thread until the semaphore pointed
+ * to by sem has a positive count. It then atomically decreases the semaphore
+ * count.
+ */
+extern DECLSPEC int SDLCALL SDL_SemWait(SDL_sem *sem);
+
+/** Non-blocking variant of SDL_SemWait().
+ * @return 0 if the wait succeeds,
+ * SDL_MUTEX_TIMEDOUT if the wait would block, and -1 on error.
+ */
+extern DECLSPEC int SDLCALL SDL_SemTryWait(SDL_sem *sem);
+
+/** Variant of SDL_SemWait() with a timeout in milliseconds, returns 0 if
+ * the wait succeeds, SDL_MUTEX_TIMEDOUT if the wait does not succeed in
+ * the allotted time, and -1 on error.
+ *
+ * On some platforms this function is implemented by looping with a delay
+ * of 1 ms, and so should be avoided if possible.
+ */
+extern DECLSPEC int SDLCALL SDL_SemWaitTimeout(SDL_sem *sem, Uint32 ms);
+
+/** Atomically increases the semaphore's count (not blocking).
+ * @return 0, or -1 on error.
+ */
+extern DECLSPEC int SDLCALL SDL_SemPost(SDL_sem *sem);
+
+/** Returns the current count of the semaphore */
+extern DECLSPEC Uint32 SDLCALL SDL_SemValue(SDL_sem *sem);
+
+/*@}*/
+
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+/** @name Condition_variable_functions */ /*@{*/
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+
+/*@{*/
+/** The SDL condition variable structure, defined in SDL_cond.c */
+struct SDL_cond;
+typedef struct SDL_cond SDL_cond;
+/*@}*/
+
+/** Create a condition variable */
+extern DECLSPEC SDL_cond * SDLCALL SDL_CreateCond(void);
+
+/** Destroy a condition variable */
+extern DECLSPEC void SDLCALL SDL_DestroyCond(SDL_cond *cond);
+
+/** Restart one of the threads that are waiting on the condition variable,
+ * @return 0 or -1 on error.
+ */
+extern DECLSPEC int SDLCALL SDL_CondSignal(SDL_cond *cond);
+
+/** Restart all threads that are waiting on the condition variable,
+ * @return 0 or -1 on error.
+ */
+extern DECLSPEC int SDLCALL SDL_CondBroadcast(SDL_cond *cond);
+
+/** Wait on the condition variable, unlocking the provided mutex.
+ * The mutex must be locked before entering this function!
+ * The mutex is re-locked once the condition variable is signaled.
+ * @return 0 when it is signaled, or -1 on error.
+ */
+extern DECLSPEC int SDLCALL SDL_CondWait(SDL_cond *cond, SDL_mutex *mut);
+
+/** Waits for at most 'ms' milliseconds, and returns 0 if the condition
+ * variable is signaled, SDL_MUTEX_TIMEDOUT if the condition is not
+ * signaled in the allotted time, and -1 on error.
+ * On some platforms this function is implemented by looping with a delay
+ * of 1 ms, and so should be avoided if possible.
+ */
+extern DECLSPEC int SDLCALL SDL_CondWaitTimeout(SDL_cond *cond, SDL_mutex *mutex, Uint32 ms);
+
+/*@}*/
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_mutex_h */
+
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_name.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_name.h
new file mode 100644
index 000000000..511619af5
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_name.h
@@ -0,0 +1,11 @@
+
+#ifndef _SDLname_h_
+#define _SDLname_h_
+
+#if defined(__STDC__) || defined(__cplusplus)
+#define NeedFunctionPrototypes 1
+#endif
+
+#define SDL_NAME(X) SDL_##X
+
+#endif /* _SDLname_h_ */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_opengl.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_opengl.h
new file mode 100644
index 000000000..c479a3a4e
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_opengl.h
@@ -0,0 +1,6556 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_opengl.h
+ * This is a simple file to encapsulate the OpenGL API headers
+ */
+
+#include "SDL_config.h"
+
+#ifdef __WIN32__
+#define WIN32_LEAN_AND_MEAN
+#ifndef NOMINMAX
+#define NOMINMAX /* Don't defined min() and max() */
+#endif
+#include
+#endif
+#ifndef NO_SDL_GLEXT
+#define __glext_h_ /* Don't let gl.h include glext.h */
+#endif
+#if defined(__MACOSX__)
+#include /* Header File For The OpenGL Library */
+#include /* Header File For The GLU Library */
+#elif defined(__MACOS__)
+#include /* Header File For The OpenGL Library */
+#include /* Header File For The GLU Library */
+#else
+#include /* Header File For The OpenGL Library */
+#include /* Header File For The GLU Library */
+#endif
+#ifndef NO_SDL_GLEXT
+#undef __glext_h_
+#endif
+
+/** @name GLext.h
+ * This file taken from "GLext.h" from the Jeff Molofee OpenGL tutorials.
+ * It is included here because glext.h is not available on some systems.
+ * If you don't want this version included, simply define "NO_SDL_GLEXT"
+ */
+/*@{*/
+#ifndef NO_SDL_GLEXT
+#if !defined(__glext_h_) && !defined(GL_GLEXT_LEGACY)
+#define __glext_h_
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/*
+** License Applicability. Except to the extent portions of this file are
+** made subject to an alternative license as permitted in the SGI Free
+** Software License B, Version 1.1 (the "License"), the contents of this
+** file are subject only to the provisions of the License. You may not use
+** this file except in compliance with the License. You may obtain a copy
+** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600
+** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at:
+**
+** http://oss.sgi.com/projects/FreeB
+**
+** Note that, as provided in the License, the Software is distributed on an
+** "AS IS" basis, with ALL EXPRESS AND IMPLIED WARRANTIES AND CONDITIONS
+** DISCLAIMED, INCLUDING, WITHOUT LIMITATION, ANY IMPLIED WARRANTIES AND
+** CONDITIONS OF MERCHANTABILITY, SATISFACTORY QUALITY, FITNESS FOR A
+** PARTICULAR PURPOSE, AND NON-INFRINGEMENT.
+**
+** Original Code. The Original Code is: OpenGL Sample Implementation,
+** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
+** Inc. The Original Code is Copyright (c) 1991-2004 Silicon Graphics, Inc.
+** Copyright in any portions created by third parties is as indicated
+** elsewhere herein. All Rights Reserved.
+**
+** Additional Notice Provisions: This software was created using the
+** OpenGL(R) version 1.2.1 Sample Implementation published by SGI, but has
+** not been independently verified as being compliant with the OpenGL(R)
+** version 1.2.1 Specification.
+*/
+
+#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__)
+#define WIN32_LEAN_AND_MEAN 1
+#include
+#endif
+
+#ifndef APIENTRY
+#define APIENTRY
+#endif
+#ifndef APIENTRYP
+#define APIENTRYP APIENTRY *
+#endif
+#ifndef GLAPI
+#define GLAPI extern
+#endif
+
+/*************************************************************/
+
+/* Header file version number, required by OpenGL ABI for Linux */
+/* glext.h last updated 2005/06/20 */
+/* Current version at http://oss.sgi.com/projects/ogl-sample/registry/ */
+#define GL_GLEXT_VERSION 29
+
+#ifndef GL_VERSION_1_2
+#define GL_UNSIGNED_BYTE_3_3_2 0x8032
+#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033
+#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034
+#define GL_UNSIGNED_INT_8_8_8_8 0x8035
+#define GL_UNSIGNED_INT_10_10_10_2 0x8036
+#define GL_RESCALE_NORMAL 0x803A
+#define GL_TEXTURE_BINDING_3D 0x806A
+#define GL_PACK_SKIP_IMAGES 0x806B
+#define GL_PACK_IMAGE_HEIGHT 0x806C
+#define GL_UNPACK_SKIP_IMAGES 0x806D
+#define GL_UNPACK_IMAGE_HEIGHT 0x806E
+#define GL_TEXTURE_3D 0x806F
+#define GL_PROXY_TEXTURE_3D 0x8070
+#define GL_TEXTURE_DEPTH 0x8071
+#define GL_TEXTURE_WRAP_R 0x8072
+#define GL_MAX_3D_TEXTURE_SIZE 0x8073
+#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362
+#define GL_UNSIGNED_SHORT_5_6_5 0x8363
+#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364
+#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365
+#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366
+#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367
+#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368
+#define GL_BGR 0x80E0
+#define GL_BGRA 0x80E1
+#define GL_MAX_ELEMENTS_VERTICES 0x80E8
+#define GL_MAX_ELEMENTS_INDICES 0x80E9
+#define GL_CLAMP_TO_EDGE 0x812F
+#define GL_TEXTURE_MIN_LOD 0x813A
+#define GL_TEXTURE_MAX_LOD 0x813B
+#define GL_TEXTURE_BASE_LEVEL 0x813C
+#define GL_TEXTURE_MAX_LEVEL 0x813D
+#define GL_LIGHT_MODEL_COLOR_CONTROL 0x81F8
+#define GL_SINGLE_COLOR 0x81F9
+#define GL_SEPARATE_SPECULAR_COLOR 0x81FA
+#define GL_SMOOTH_POINT_SIZE_RANGE 0x0B12
+#define GL_SMOOTH_POINT_SIZE_GRANULARITY 0x0B13
+#define GL_SMOOTH_LINE_WIDTH_RANGE 0x0B22
+#define GL_SMOOTH_LINE_WIDTH_GRANULARITY 0x0B23
+#define GL_ALIASED_POINT_SIZE_RANGE 0x846D
+#define GL_ALIASED_LINE_WIDTH_RANGE 0x846E
+#endif
+
+#ifndef GL_ARB_imaging
+#define GL_CONSTANT_COLOR 0x8001
+#define GL_ONE_MINUS_CONSTANT_COLOR 0x8002
+#define GL_CONSTANT_ALPHA 0x8003
+#define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004
+#define GL_BLEND_COLOR 0x8005
+#define GL_FUNC_ADD 0x8006
+#define GL_MIN 0x8007
+#define GL_MAX 0x8008
+#define GL_BLEND_EQUATION 0x8009
+#define GL_FUNC_SUBTRACT 0x800A
+#define GL_FUNC_REVERSE_SUBTRACT 0x800B
+#define GL_CONVOLUTION_1D 0x8010
+#define GL_CONVOLUTION_2D 0x8011
+#define GL_SEPARABLE_2D 0x8012
+#define GL_CONVOLUTION_BORDER_MODE 0x8013
+#define GL_CONVOLUTION_FILTER_SCALE 0x8014
+#define GL_CONVOLUTION_FILTER_BIAS 0x8015
+#define GL_REDUCE 0x8016
+#define GL_CONVOLUTION_FORMAT 0x8017
+#define GL_CONVOLUTION_WIDTH 0x8018
+#define GL_CONVOLUTION_HEIGHT 0x8019
+#define GL_MAX_CONVOLUTION_WIDTH 0x801A
+#define GL_MAX_CONVOLUTION_HEIGHT 0x801B
+#define GL_POST_CONVOLUTION_RED_SCALE 0x801C
+#define GL_POST_CONVOLUTION_GREEN_SCALE 0x801D
+#define GL_POST_CONVOLUTION_BLUE_SCALE 0x801E
+#define GL_POST_CONVOLUTION_ALPHA_SCALE 0x801F
+#define GL_POST_CONVOLUTION_RED_BIAS 0x8020
+#define GL_POST_CONVOLUTION_GREEN_BIAS 0x8021
+#define GL_POST_CONVOLUTION_BLUE_BIAS 0x8022
+#define GL_POST_CONVOLUTION_ALPHA_BIAS 0x8023
+#define GL_HISTOGRAM 0x8024
+#define GL_PROXY_HISTOGRAM 0x8025
+#define GL_HISTOGRAM_WIDTH 0x8026
+#define GL_HISTOGRAM_FORMAT 0x8027
+#define GL_HISTOGRAM_RED_SIZE 0x8028
+#define GL_HISTOGRAM_GREEN_SIZE 0x8029
+#define GL_HISTOGRAM_BLUE_SIZE 0x802A
+#define GL_HISTOGRAM_ALPHA_SIZE 0x802B
+#define GL_HISTOGRAM_LUMINANCE_SIZE 0x802C
+#define GL_HISTOGRAM_SINK 0x802D
+#define GL_MINMAX 0x802E
+#define GL_MINMAX_FORMAT 0x802F
+#define GL_MINMAX_SINK 0x8030
+#define GL_TABLE_TOO_LARGE 0x8031
+#define GL_COLOR_MATRIX 0x80B1
+#define GL_COLOR_MATRIX_STACK_DEPTH 0x80B2
+#define GL_MAX_COLOR_MATRIX_STACK_DEPTH 0x80B3
+#define GL_POST_COLOR_MATRIX_RED_SCALE 0x80B4
+#define GL_POST_COLOR_MATRIX_GREEN_SCALE 0x80B5
+#define GL_POST_COLOR_MATRIX_BLUE_SCALE 0x80B6
+#define GL_POST_COLOR_MATRIX_ALPHA_SCALE 0x80B7
+#define GL_POST_COLOR_MATRIX_RED_BIAS 0x80B8
+#define GL_POST_COLOR_MATRIX_GREEN_BIAS 0x80B9
+#define GL_POST_COLOR_MATRIX_BLUE_BIAS 0x80BA
+#define GL_POST_COLOR_MATRIX_ALPHA_BIAS 0x80BB
+#define GL_COLOR_TABLE 0x80D0
+#define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1
+#define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2
+#define GL_PROXY_COLOR_TABLE 0x80D3
+#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4
+#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5
+#define GL_COLOR_TABLE_SCALE 0x80D6
+#define GL_COLOR_TABLE_BIAS 0x80D7
+#define GL_COLOR_TABLE_FORMAT 0x80D8
+#define GL_COLOR_TABLE_WIDTH 0x80D9
+#define GL_COLOR_TABLE_RED_SIZE 0x80DA
+#define GL_COLOR_TABLE_GREEN_SIZE 0x80DB
+#define GL_COLOR_TABLE_BLUE_SIZE 0x80DC
+#define GL_COLOR_TABLE_ALPHA_SIZE 0x80DD
+#define GL_COLOR_TABLE_LUMINANCE_SIZE 0x80DE
+#define GL_COLOR_TABLE_INTENSITY_SIZE 0x80DF
+#define GL_CONSTANT_BORDER 0x8151
+#define GL_REPLICATE_BORDER 0x8153
+#define GL_CONVOLUTION_BORDER_COLOR 0x8154
+#endif
+
+#ifndef GL_VERSION_1_3
+#define GL_TEXTURE0 0x84C0
+#define GL_TEXTURE1 0x84C1
+#define GL_TEXTURE2 0x84C2
+#define GL_TEXTURE3 0x84C3
+#define GL_TEXTURE4 0x84C4
+#define GL_TEXTURE5 0x84C5
+#define GL_TEXTURE6 0x84C6
+#define GL_TEXTURE7 0x84C7
+#define GL_TEXTURE8 0x84C8
+#define GL_TEXTURE9 0x84C9
+#define GL_TEXTURE10 0x84CA
+#define GL_TEXTURE11 0x84CB
+#define GL_TEXTURE12 0x84CC
+#define GL_TEXTURE13 0x84CD
+#define GL_TEXTURE14 0x84CE
+#define GL_TEXTURE15 0x84CF
+#define GL_TEXTURE16 0x84D0
+#define GL_TEXTURE17 0x84D1
+#define GL_TEXTURE18 0x84D2
+#define GL_TEXTURE19 0x84D3
+#define GL_TEXTURE20 0x84D4
+#define GL_TEXTURE21 0x84D5
+#define GL_TEXTURE22 0x84D6
+#define GL_TEXTURE23 0x84D7
+#define GL_TEXTURE24 0x84D8
+#define GL_TEXTURE25 0x84D9
+#define GL_TEXTURE26 0x84DA
+#define GL_TEXTURE27 0x84DB
+#define GL_TEXTURE28 0x84DC
+#define GL_TEXTURE29 0x84DD
+#define GL_TEXTURE30 0x84DE
+#define GL_TEXTURE31 0x84DF
+#define GL_ACTIVE_TEXTURE 0x84E0
+#define GL_CLIENT_ACTIVE_TEXTURE 0x84E1
+#define GL_MAX_TEXTURE_UNITS 0x84E2
+#define GL_TRANSPOSE_MODELVIEW_MATRIX 0x84E3
+#define GL_TRANSPOSE_PROJECTION_MATRIX 0x84E4
+#define GL_TRANSPOSE_TEXTURE_MATRIX 0x84E5
+#define GL_TRANSPOSE_COLOR_MATRIX 0x84E6
+#define GL_MULTISAMPLE 0x809D
+#define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E
+#define GL_SAMPLE_ALPHA_TO_ONE 0x809F
+#define GL_SAMPLE_COVERAGE 0x80A0
+#define GL_SAMPLE_BUFFERS 0x80A8
+#define GL_SAMPLES 0x80A9
+#define GL_SAMPLE_COVERAGE_VALUE 0x80AA
+#define GL_SAMPLE_COVERAGE_INVERT 0x80AB
+#define GL_MULTISAMPLE_BIT 0x20000000
+#define GL_NORMAL_MAP 0x8511
+#define GL_REFLECTION_MAP 0x8512
+#define GL_TEXTURE_CUBE_MAP 0x8513
+#define GL_TEXTURE_BINDING_CUBE_MAP 0x8514
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x8516
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x8517
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x8518
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A
+#define GL_PROXY_TEXTURE_CUBE_MAP 0x851B
+#define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C
+#define GL_COMPRESSED_ALPHA 0x84E9
+#define GL_COMPRESSED_LUMINANCE 0x84EA
+#define GL_COMPRESSED_LUMINANCE_ALPHA 0x84EB
+#define GL_COMPRESSED_INTENSITY 0x84EC
+#define GL_COMPRESSED_RGB 0x84ED
+#define GL_COMPRESSED_RGBA 0x84EE
+#define GL_TEXTURE_COMPRESSION_HINT 0x84EF
+#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE 0x86A0
+#define GL_TEXTURE_COMPRESSED 0x86A1
+#define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2
+#define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3
+#define GL_CLAMP_TO_BORDER 0x812D
+#define GL_COMBINE 0x8570
+#define GL_COMBINE_RGB 0x8571
+#define GL_COMBINE_ALPHA 0x8572
+#define GL_SOURCE0_RGB 0x8580
+#define GL_SOURCE1_RGB 0x8581
+#define GL_SOURCE2_RGB 0x8582
+#define GL_SOURCE0_ALPHA 0x8588
+#define GL_SOURCE1_ALPHA 0x8589
+#define GL_SOURCE2_ALPHA 0x858A
+#define GL_OPERAND0_RGB 0x8590
+#define GL_OPERAND1_RGB 0x8591
+#define GL_OPERAND2_RGB 0x8592
+#define GL_OPERAND0_ALPHA 0x8598
+#define GL_OPERAND1_ALPHA 0x8599
+#define GL_OPERAND2_ALPHA 0x859A
+#define GL_RGB_SCALE 0x8573
+#define GL_ADD_SIGNED 0x8574
+#define GL_INTERPOLATE 0x8575
+#define GL_SUBTRACT 0x84E7
+#define GL_CONSTANT 0x8576
+#define GL_PRIMARY_COLOR 0x8577
+#define GL_PREVIOUS 0x8578
+#define GL_DOT3_RGB 0x86AE
+#define GL_DOT3_RGBA 0x86AF
+#endif
+
+#ifndef GL_VERSION_1_4
+#define GL_BLEND_DST_RGB 0x80C8
+#define GL_BLEND_SRC_RGB 0x80C9
+#define GL_BLEND_DST_ALPHA 0x80CA
+#define GL_BLEND_SRC_ALPHA 0x80CB
+#define GL_POINT_SIZE_MIN 0x8126
+#define GL_POINT_SIZE_MAX 0x8127
+#define GL_POINT_FADE_THRESHOLD_SIZE 0x8128
+#define GL_POINT_DISTANCE_ATTENUATION 0x8129
+#define GL_GENERATE_MIPMAP 0x8191
+#define GL_GENERATE_MIPMAP_HINT 0x8192
+#define GL_DEPTH_COMPONENT16 0x81A5
+#define GL_DEPTH_COMPONENT24 0x81A6
+#define GL_DEPTH_COMPONENT32 0x81A7
+#define GL_MIRRORED_REPEAT 0x8370
+#define GL_FOG_COORDINATE_SOURCE 0x8450
+#define GL_FOG_COORDINATE 0x8451
+#define GL_FRAGMENT_DEPTH 0x8452
+#define GL_CURRENT_FOG_COORDINATE 0x8453
+#define GL_FOG_COORDINATE_ARRAY_TYPE 0x8454
+#define GL_FOG_COORDINATE_ARRAY_STRIDE 0x8455
+#define GL_FOG_COORDINATE_ARRAY_POINTER 0x8456
+#define GL_FOG_COORDINATE_ARRAY 0x8457
+#define GL_COLOR_SUM 0x8458
+#define GL_CURRENT_SECONDARY_COLOR 0x8459
+#define GL_SECONDARY_COLOR_ARRAY_SIZE 0x845A
+#define GL_SECONDARY_COLOR_ARRAY_TYPE 0x845B
+#define GL_SECONDARY_COLOR_ARRAY_STRIDE 0x845C
+#define GL_SECONDARY_COLOR_ARRAY_POINTER 0x845D
+#define GL_SECONDARY_COLOR_ARRAY 0x845E
+#define GL_MAX_TEXTURE_LOD_BIAS 0x84FD
+#define GL_TEXTURE_FILTER_CONTROL 0x8500
+#define GL_TEXTURE_LOD_BIAS 0x8501
+#define GL_INCR_WRAP 0x8507
+#define GL_DECR_WRAP 0x8508
+#define GL_TEXTURE_DEPTH_SIZE 0x884A
+#define GL_DEPTH_TEXTURE_MODE 0x884B
+#define GL_TEXTURE_COMPARE_MODE 0x884C
+#define GL_TEXTURE_COMPARE_FUNC 0x884D
+#define GL_COMPARE_R_TO_TEXTURE 0x884E
+#endif
+
+#ifndef GL_VERSION_1_5
+#define GL_BUFFER_SIZE 0x8764
+#define GL_BUFFER_USAGE 0x8765
+#define GL_QUERY_COUNTER_BITS 0x8864
+#define GL_CURRENT_QUERY 0x8865
+#define GL_QUERY_RESULT 0x8866
+#define GL_QUERY_RESULT_AVAILABLE 0x8867
+#define GL_ARRAY_BUFFER 0x8892
+#define GL_ELEMENT_ARRAY_BUFFER 0x8893
+#define GL_ARRAY_BUFFER_BINDING 0x8894
+#define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895
+#define GL_VERTEX_ARRAY_BUFFER_BINDING 0x8896
+#define GL_NORMAL_ARRAY_BUFFER_BINDING 0x8897
+#define GL_COLOR_ARRAY_BUFFER_BINDING 0x8898
+#define GL_INDEX_ARRAY_BUFFER_BINDING 0x8899
+#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING 0x889A
+#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING 0x889B
+#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING 0x889C
+#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING 0x889D
+#define GL_WEIGHT_ARRAY_BUFFER_BINDING 0x889E
+#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F
+#define GL_READ_ONLY 0x88B8
+#define GL_WRITE_ONLY 0x88B9
+#define GL_READ_WRITE 0x88BA
+#define GL_BUFFER_ACCESS 0x88BB
+#define GL_BUFFER_MAPPED 0x88BC
+#define GL_BUFFER_MAP_POINTER 0x88BD
+#define GL_STREAM_DRAW 0x88E0
+#define GL_STREAM_READ 0x88E1
+#define GL_STREAM_COPY 0x88E2
+#define GL_STATIC_DRAW 0x88E4
+#define GL_STATIC_READ 0x88E5
+#define GL_STATIC_COPY 0x88E6
+#define GL_DYNAMIC_DRAW 0x88E8
+#define GL_DYNAMIC_READ 0x88E9
+#define GL_DYNAMIC_COPY 0x88EA
+#define GL_SAMPLES_PASSED 0x8914
+#define GL_FOG_COORD_SRC GL_FOG_COORDINATE_SOURCE
+#define GL_FOG_COORD GL_FOG_COORDINATE
+#define GL_CURRENT_FOG_COORD GL_CURRENT_FOG_COORDINATE
+#define GL_FOG_COORD_ARRAY_TYPE GL_FOG_COORDINATE_ARRAY_TYPE
+#define GL_FOG_COORD_ARRAY_STRIDE GL_FOG_COORDINATE_ARRAY_STRIDE
+#define GL_FOG_COORD_ARRAY_POINTER GL_FOG_COORDINATE_ARRAY_POINTER
+#define GL_FOG_COORD_ARRAY GL_FOG_COORDINATE_ARRAY
+#define GL_FOG_COORD_ARRAY_BUFFER_BINDING GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING
+#define GL_SRC0_RGB GL_SOURCE0_RGB
+#define GL_SRC1_RGB GL_SOURCE1_RGB
+#define GL_SRC2_RGB GL_SOURCE2_RGB
+#define GL_SRC0_ALPHA GL_SOURCE0_ALPHA
+#define GL_SRC1_ALPHA GL_SOURCE1_ALPHA
+#define GL_SRC2_ALPHA GL_SOURCE2_ALPHA
+#endif
+
+#ifndef GL_VERSION_2_0
+#define GL_BLEND_EQUATION_RGB GL_BLEND_EQUATION
+#define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622
+#define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623
+#define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624
+#define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625
+#define GL_CURRENT_VERTEX_ATTRIB 0x8626
+#define GL_VERTEX_PROGRAM_POINT_SIZE 0x8642
+#define GL_VERTEX_PROGRAM_TWO_SIDE 0x8643
+#define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645
+#define GL_STENCIL_BACK_FUNC 0x8800
+#define GL_STENCIL_BACK_FAIL 0x8801
+#define GL_STENCIL_BACK_PASS_DEPTH_FAIL 0x8802
+#define GL_STENCIL_BACK_PASS_DEPTH_PASS 0x8803
+#define GL_MAX_DRAW_BUFFERS 0x8824
+#define GL_DRAW_BUFFER0 0x8825
+#define GL_DRAW_BUFFER1 0x8826
+#define GL_DRAW_BUFFER2 0x8827
+#define GL_DRAW_BUFFER3 0x8828
+#define GL_DRAW_BUFFER4 0x8829
+#define GL_DRAW_BUFFER5 0x882A
+#define GL_DRAW_BUFFER6 0x882B
+#define GL_DRAW_BUFFER7 0x882C
+#define GL_DRAW_BUFFER8 0x882D
+#define GL_DRAW_BUFFER9 0x882E
+#define GL_DRAW_BUFFER10 0x882F
+#define GL_DRAW_BUFFER11 0x8830
+#define GL_DRAW_BUFFER12 0x8831
+#define GL_DRAW_BUFFER13 0x8832
+#define GL_DRAW_BUFFER14 0x8833
+#define GL_DRAW_BUFFER15 0x8834
+#define GL_BLEND_EQUATION_ALPHA 0x883D
+#define GL_POINT_SPRITE 0x8861
+#define GL_COORD_REPLACE 0x8862
+#define GL_MAX_VERTEX_ATTRIBS 0x8869
+#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A
+#define GL_MAX_TEXTURE_COORDS 0x8871
+#define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872
+#define GL_FRAGMENT_SHADER 0x8B30
+#define GL_VERTEX_SHADER 0x8B31
+#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49
+#define GL_MAX_VERTEX_UNIFORM_COMPONENTS 0x8B4A
+#define GL_MAX_VARYING_FLOATS 0x8B4B
+#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C
+#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D
+#define GL_SHADER_TYPE 0x8B4F
+#define GL_FLOAT_VEC2 0x8B50
+#define GL_FLOAT_VEC3 0x8B51
+#define GL_FLOAT_VEC4 0x8B52
+#define GL_INT_VEC2 0x8B53
+#define GL_INT_VEC3 0x8B54
+#define GL_INT_VEC4 0x8B55
+#define GL_BOOL 0x8B56
+#define GL_BOOL_VEC2 0x8B57
+#define GL_BOOL_VEC3 0x8B58
+#define GL_BOOL_VEC4 0x8B59
+#define GL_FLOAT_MAT2 0x8B5A
+#define GL_FLOAT_MAT3 0x8B5B
+#define GL_FLOAT_MAT4 0x8B5C
+#define GL_SAMPLER_1D 0x8B5D
+#define GL_SAMPLER_2D 0x8B5E
+#define GL_SAMPLER_3D 0x8B5F
+#define GL_SAMPLER_CUBE 0x8B60
+#define GL_SAMPLER_1D_SHADOW 0x8B61
+#define GL_SAMPLER_2D_SHADOW 0x8B62
+#define GL_DELETE_STATUS 0x8B80
+#define GL_COMPILE_STATUS 0x8B81
+#define GL_LINK_STATUS 0x8B82
+#define GL_VALIDATE_STATUS 0x8B83
+#define GL_INFO_LOG_LENGTH 0x8B84
+#define GL_ATTACHED_SHADERS 0x8B85
+#define GL_ACTIVE_UNIFORMS 0x8B86
+#define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87
+#define GL_SHADER_SOURCE_LENGTH 0x8B88
+#define GL_ACTIVE_ATTRIBUTES 0x8B89
+#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A
+#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B
+#define GL_SHADING_LANGUAGE_VERSION 0x8B8C
+#define GL_CURRENT_PROGRAM 0x8B8D
+#define GL_POINT_SPRITE_COORD_ORIGIN 0x8CA0
+#define GL_LOWER_LEFT 0x8CA1
+#define GL_UPPER_LEFT 0x8CA2
+#define GL_STENCIL_BACK_REF 0x8CA3
+#define GL_STENCIL_BACK_VALUE_MASK 0x8CA4
+#define GL_STENCIL_BACK_WRITEMASK 0x8CA5
+#endif
+
+#ifndef GL_ARB_multitexture
+#define GL_TEXTURE0_ARB 0x84C0
+#define GL_TEXTURE1_ARB 0x84C1
+#define GL_TEXTURE2_ARB 0x84C2
+#define GL_TEXTURE3_ARB 0x84C3
+#define GL_TEXTURE4_ARB 0x84C4
+#define GL_TEXTURE5_ARB 0x84C5
+#define GL_TEXTURE6_ARB 0x84C6
+#define GL_TEXTURE7_ARB 0x84C7
+#define GL_TEXTURE8_ARB 0x84C8
+#define GL_TEXTURE9_ARB 0x84C9
+#define GL_TEXTURE10_ARB 0x84CA
+#define GL_TEXTURE11_ARB 0x84CB
+#define GL_TEXTURE12_ARB 0x84CC
+#define GL_TEXTURE13_ARB 0x84CD
+#define GL_TEXTURE14_ARB 0x84CE
+#define GL_TEXTURE15_ARB 0x84CF
+#define GL_TEXTURE16_ARB 0x84D0
+#define GL_TEXTURE17_ARB 0x84D1
+#define GL_TEXTURE18_ARB 0x84D2
+#define GL_TEXTURE19_ARB 0x84D3
+#define GL_TEXTURE20_ARB 0x84D4
+#define GL_TEXTURE21_ARB 0x84D5
+#define GL_TEXTURE22_ARB 0x84D6
+#define GL_TEXTURE23_ARB 0x84D7
+#define GL_TEXTURE24_ARB 0x84D8
+#define GL_TEXTURE25_ARB 0x84D9
+#define GL_TEXTURE26_ARB 0x84DA
+#define GL_TEXTURE27_ARB 0x84DB
+#define GL_TEXTURE28_ARB 0x84DC
+#define GL_TEXTURE29_ARB 0x84DD
+#define GL_TEXTURE30_ARB 0x84DE
+#define GL_TEXTURE31_ARB 0x84DF
+#define GL_ACTIVE_TEXTURE_ARB 0x84E0
+#define GL_CLIENT_ACTIVE_TEXTURE_ARB 0x84E1
+#define GL_MAX_TEXTURE_UNITS_ARB 0x84E2
+#endif
+
+#ifndef GL_ARB_transpose_matrix
+#define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3
+#define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4
+#define GL_TRANSPOSE_TEXTURE_MATRIX_ARB 0x84E5
+#define GL_TRANSPOSE_COLOR_MATRIX_ARB 0x84E6
+#endif
+
+#ifndef GL_ARB_multisample
+#define GL_MULTISAMPLE_ARB 0x809D
+#define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB 0x809E
+#define GL_SAMPLE_ALPHA_TO_ONE_ARB 0x809F
+#define GL_SAMPLE_COVERAGE_ARB 0x80A0
+#define GL_SAMPLE_BUFFERS_ARB 0x80A8
+#define GL_SAMPLES_ARB 0x80A9
+#define GL_SAMPLE_COVERAGE_VALUE_ARB 0x80AA
+#define GL_SAMPLE_COVERAGE_INVERT_ARB 0x80AB
+#define GL_MULTISAMPLE_BIT_ARB 0x20000000
+#endif
+
+#ifndef GL_ARB_texture_env_add
+#endif
+
+#ifndef GL_ARB_texture_cube_map
+#define GL_NORMAL_MAP_ARB 0x8511
+#define GL_REFLECTION_MAP_ARB 0x8512
+#define GL_TEXTURE_CUBE_MAP_ARB 0x8513
+#define GL_TEXTURE_BINDING_CUBE_MAP_ARB 0x8514
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A
+#define GL_PROXY_TEXTURE_CUBE_MAP_ARB 0x851B
+#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB 0x851C
+#endif
+
+#ifndef GL_ARB_texture_compression
+#define GL_COMPRESSED_ALPHA_ARB 0x84E9
+#define GL_COMPRESSED_LUMINANCE_ARB 0x84EA
+#define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB
+#define GL_COMPRESSED_INTENSITY_ARB 0x84EC
+#define GL_COMPRESSED_RGB_ARB 0x84ED
+#define GL_COMPRESSED_RGBA_ARB 0x84EE
+#define GL_TEXTURE_COMPRESSION_HINT_ARB 0x84EF
+#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE_ARB 0x86A0
+#define GL_TEXTURE_COMPRESSED_ARB 0x86A1
+#define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2
+#define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3
+#endif
+
+#ifndef GL_ARB_texture_border_clamp
+#define GL_CLAMP_TO_BORDER_ARB 0x812D
+#endif
+
+#ifndef GL_ARB_point_parameters
+#define GL_POINT_SIZE_MIN_ARB 0x8126
+#define GL_POINT_SIZE_MAX_ARB 0x8127
+#define GL_POINT_FADE_THRESHOLD_SIZE_ARB 0x8128
+#define GL_POINT_DISTANCE_ATTENUATION_ARB 0x8129
+#endif
+
+#ifndef GL_ARB_vertex_blend
+#define GL_MAX_VERTEX_UNITS_ARB 0x86A4
+#define GL_ACTIVE_VERTEX_UNITS_ARB 0x86A5
+#define GL_WEIGHT_SUM_UNITY_ARB 0x86A6
+#define GL_VERTEX_BLEND_ARB 0x86A7
+#define GL_CURRENT_WEIGHT_ARB 0x86A8
+#define GL_WEIGHT_ARRAY_TYPE_ARB 0x86A9
+#define GL_WEIGHT_ARRAY_STRIDE_ARB 0x86AA
+#define GL_WEIGHT_ARRAY_SIZE_ARB 0x86AB
+#define GL_WEIGHT_ARRAY_POINTER_ARB 0x86AC
+#define GL_WEIGHT_ARRAY_ARB 0x86AD
+#define GL_MODELVIEW0_ARB 0x1700
+#define GL_MODELVIEW1_ARB 0x850A
+#define GL_MODELVIEW2_ARB 0x8722
+#define GL_MODELVIEW3_ARB 0x8723
+#define GL_MODELVIEW4_ARB 0x8724
+#define GL_MODELVIEW5_ARB 0x8725
+#define GL_MODELVIEW6_ARB 0x8726
+#define GL_MODELVIEW7_ARB 0x8727
+#define GL_MODELVIEW8_ARB 0x8728
+#define GL_MODELVIEW9_ARB 0x8729
+#define GL_MODELVIEW10_ARB 0x872A
+#define GL_MODELVIEW11_ARB 0x872B
+#define GL_MODELVIEW12_ARB 0x872C
+#define GL_MODELVIEW13_ARB 0x872D
+#define GL_MODELVIEW14_ARB 0x872E
+#define GL_MODELVIEW15_ARB 0x872F
+#define GL_MODELVIEW16_ARB 0x8730
+#define GL_MODELVIEW17_ARB 0x8731
+#define GL_MODELVIEW18_ARB 0x8732
+#define GL_MODELVIEW19_ARB 0x8733
+#define GL_MODELVIEW20_ARB 0x8734
+#define GL_MODELVIEW21_ARB 0x8735
+#define GL_MODELVIEW22_ARB 0x8736
+#define GL_MODELVIEW23_ARB 0x8737
+#define GL_MODELVIEW24_ARB 0x8738
+#define GL_MODELVIEW25_ARB 0x8739
+#define GL_MODELVIEW26_ARB 0x873A
+#define GL_MODELVIEW27_ARB 0x873B
+#define GL_MODELVIEW28_ARB 0x873C
+#define GL_MODELVIEW29_ARB 0x873D
+#define GL_MODELVIEW30_ARB 0x873E
+#define GL_MODELVIEW31_ARB 0x873F
+#endif
+
+#ifndef GL_ARB_matrix_palette
+#define GL_MATRIX_PALETTE_ARB 0x8840
+#define GL_MAX_MATRIX_PALETTE_STACK_DEPTH_ARB 0x8841
+#define GL_MAX_PALETTE_MATRICES_ARB 0x8842
+#define GL_CURRENT_PALETTE_MATRIX_ARB 0x8843
+#define GL_MATRIX_INDEX_ARRAY_ARB 0x8844
+#define GL_CURRENT_MATRIX_INDEX_ARB 0x8845
+#define GL_MATRIX_INDEX_ARRAY_SIZE_ARB 0x8846
+#define GL_MATRIX_INDEX_ARRAY_TYPE_ARB 0x8847
+#define GL_MATRIX_INDEX_ARRAY_STRIDE_ARB 0x8848
+#define GL_MATRIX_INDEX_ARRAY_POINTER_ARB 0x8849
+#endif
+
+#ifndef GL_ARB_texture_env_combine
+#define GL_COMBINE_ARB 0x8570
+#define GL_COMBINE_RGB_ARB 0x8571
+#define GL_COMBINE_ALPHA_ARB 0x8572
+#define GL_SOURCE0_RGB_ARB 0x8580
+#define GL_SOURCE1_RGB_ARB 0x8581
+#define GL_SOURCE2_RGB_ARB 0x8582
+#define GL_SOURCE0_ALPHA_ARB 0x8588
+#define GL_SOURCE1_ALPHA_ARB 0x8589
+#define GL_SOURCE2_ALPHA_ARB 0x858A
+#define GL_OPERAND0_RGB_ARB 0x8590
+#define GL_OPERAND1_RGB_ARB 0x8591
+#define GL_OPERAND2_RGB_ARB 0x8592
+#define GL_OPERAND0_ALPHA_ARB 0x8598
+#define GL_OPERAND1_ALPHA_ARB 0x8599
+#define GL_OPERAND2_ALPHA_ARB 0x859A
+#define GL_RGB_SCALE_ARB 0x8573
+#define GL_ADD_SIGNED_ARB 0x8574
+#define GL_INTERPOLATE_ARB 0x8575
+#define GL_SUBTRACT_ARB 0x84E7
+#define GL_CONSTANT_ARB 0x8576
+#define GL_PRIMARY_COLOR_ARB 0x8577
+#define GL_PREVIOUS_ARB 0x8578
+#endif
+
+#ifndef GL_ARB_texture_env_crossbar
+#endif
+
+#ifndef GL_ARB_texture_env_dot3
+#define GL_DOT3_RGB_ARB 0x86AE
+#define GL_DOT3_RGBA_ARB 0x86AF
+#endif
+
+#ifndef GL_ARB_texture_mirrored_repeat
+#define GL_MIRRORED_REPEAT_ARB 0x8370
+#endif
+
+#ifndef GL_ARB_depth_texture
+#define GL_DEPTH_COMPONENT16_ARB 0x81A5
+#define GL_DEPTH_COMPONENT24_ARB 0x81A6
+#define GL_DEPTH_COMPONENT32_ARB 0x81A7
+#define GL_TEXTURE_DEPTH_SIZE_ARB 0x884A
+#define GL_DEPTH_TEXTURE_MODE_ARB 0x884B
+#endif
+
+#ifndef GL_ARB_shadow
+#define GL_TEXTURE_COMPARE_MODE_ARB 0x884C
+#define GL_TEXTURE_COMPARE_FUNC_ARB 0x884D
+#define GL_COMPARE_R_TO_TEXTURE_ARB 0x884E
+#endif
+
+#ifndef GL_ARB_shadow_ambient
+#define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF
+#endif
+
+#ifndef GL_ARB_window_pos
+#endif
+
+#ifndef GL_ARB_vertex_program
+#define GL_COLOR_SUM_ARB 0x8458
+#define GL_VERTEX_PROGRAM_ARB 0x8620
+#define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB 0x8622
+#define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB 0x8623
+#define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB 0x8624
+#define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB 0x8625
+#define GL_CURRENT_VERTEX_ATTRIB_ARB 0x8626
+#define GL_PROGRAM_LENGTH_ARB 0x8627
+#define GL_PROGRAM_STRING_ARB 0x8628
+#define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB 0x862E
+#define GL_MAX_PROGRAM_MATRICES_ARB 0x862F
+#define GL_CURRENT_MATRIX_STACK_DEPTH_ARB 0x8640
+#define GL_CURRENT_MATRIX_ARB 0x8641
+#define GL_VERTEX_PROGRAM_POINT_SIZE_ARB 0x8642
+#define GL_VERTEX_PROGRAM_TWO_SIDE_ARB 0x8643
+#define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB 0x8645
+#define GL_PROGRAM_ERROR_POSITION_ARB 0x864B
+#define GL_PROGRAM_BINDING_ARB 0x8677
+#define GL_MAX_VERTEX_ATTRIBS_ARB 0x8869
+#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB 0x886A
+#define GL_PROGRAM_ERROR_STRING_ARB 0x8874
+#define GL_PROGRAM_FORMAT_ASCII_ARB 0x8875
+#define GL_PROGRAM_FORMAT_ARB 0x8876
+#define GL_PROGRAM_INSTRUCTIONS_ARB 0x88A0
+#define GL_MAX_PROGRAM_INSTRUCTIONS_ARB 0x88A1
+#define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A2
+#define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A3
+#define GL_PROGRAM_TEMPORARIES_ARB 0x88A4
+#define GL_MAX_PROGRAM_TEMPORARIES_ARB 0x88A5
+#define GL_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A6
+#define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A7
+#define GL_PROGRAM_PARAMETERS_ARB 0x88A8
+#define GL_MAX_PROGRAM_PARAMETERS_ARB 0x88A9
+#define GL_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AA
+#define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AB
+#define GL_PROGRAM_ATTRIBS_ARB 0x88AC
+#define GL_MAX_PROGRAM_ATTRIBS_ARB 0x88AD
+#define GL_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AE
+#define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AF
+#define GL_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B0
+#define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B1
+#define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B2
+#define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3
+#define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB 0x88B4
+#define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB 0x88B5
+#define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB 0x88B6
+#define GL_TRANSPOSE_CURRENT_MATRIX_ARB 0x88B7
+#define GL_MATRIX0_ARB 0x88C0
+#define GL_MATRIX1_ARB 0x88C1
+#define GL_MATRIX2_ARB 0x88C2
+#define GL_MATRIX3_ARB 0x88C3
+#define GL_MATRIX4_ARB 0x88C4
+#define GL_MATRIX5_ARB 0x88C5
+#define GL_MATRIX6_ARB 0x88C6
+#define GL_MATRIX7_ARB 0x88C7
+#define GL_MATRIX8_ARB 0x88C8
+#define GL_MATRIX9_ARB 0x88C9
+#define GL_MATRIX10_ARB 0x88CA
+#define GL_MATRIX11_ARB 0x88CB
+#define GL_MATRIX12_ARB 0x88CC
+#define GL_MATRIX13_ARB 0x88CD
+#define GL_MATRIX14_ARB 0x88CE
+#define GL_MATRIX15_ARB 0x88CF
+#define GL_MATRIX16_ARB 0x88D0
+#define GL_MATRIX17_ARB 0x88D1
+#define GL_MATRIX18_ARB 0x88D2
+#define GL_MATRIX19_ARB 0x88D3
+#define GL_MATRIX20_ARB 0x88D4
+#define GL_MATRIX21_ARB 0x88D5
+#define GL_MATRIX22_ARB 0x88D6
+#define GL_MATRIX23_ARB 0x88D7
+#define GL_MATRIX24_ARB 0x88D8
+#define GL_MATRIX25_ARB 0x88D9
+#define GL_MATRIX26_ARB 0x88DA
+#define GL_MATRIX27_ARB 0x88DB
+#define GL_MATRIX28_ARB 0x88DC
+#define GL_MATRIX29_ARB 0x88DD
+#define GL_MATRIX30_ARB 0x88DE
+#define GL_MATRIX31_ARB 0x88DF
+#endif
+
+#ifndef GL_ARB_fragment_program
+#define GL_FRAGMENT_PROGRAM_ARB 0x8804
+#define GL_PROGRAM_ALU_INSTRUCTIONS_ARB 0x8805
+#define GL_PROGRAM_TEX_INSTRUCTIONS_ARB 0x8806
+#define GL_PROGRAM_TEX_INDIRECTIONS_ARB 0x8807
+#define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x8808
+#define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x8809
+#define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x880A
+#define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB 0x880B
+#define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB 0x880C
+#define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB 0x880D
+#define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x880E
+#define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x880F
+#define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x8810
+#define GL_MAX_TEXTURE_COORDS_ARB 0x8871
+#define GL_MAX_TEXTURE_IMAGE_UNITS_ARB 0x8872
+#endif
+
+#ifndef GL_ARB_vertex_buffer_object
+#define GL_BUFFER_SIZE_ARB 0x8764
+#define GL_BUFFER_USAGE_ARB 0x8765
+#define GL_ARRAY_BUFFER_ARB 0x8892
+#define GL_ELEMENT_ARRAY_BUFFER_ARB 0x8893
+#define GL_ARRAY_BUFFER_BINDING_ARB 0x8894
+#define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB 0x8895
+#define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB 0x8896
+#define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB 0x8897
+#define GL_COLOR_ARRAY_BUFFER_BINDING_ARB 0x8898
+#define GL_INDEX_ARRAY_BUFFER_BINDING_ARB 0x8899
+#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB 0x889A
+#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB 0x889B
+#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB 0x889C
+#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB 0x889D
+#define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB 0x889E
+#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB 0x889F
+#define GL_READ_ONLY_ARB 0x88B8
+#define GL_WRITE_ONLY_ARB 0x88B9
+#define GL_READ_WRITE_ARB 0x88BA
+#define GL_BUFFER_ACCESS_ARB 0x88BB
+#define GL_BUFFER_MAPPED_ARB 0x88BC
+#define GL_BUFFER_MAP_POINTER_ARB 0x88BD
+#define GL_STREAM_DRAW_ARB 0x88E0
+#define GL_STREAM_READ_ARB 0x88E1
+#define GL_STREAM_COPY_ARB 0x88E2
+#define GL_STATIC_DRAW_ARB 0x88E4
+#define GL_STATIC_READ_ARB 0x88E5
+#define GL_STATIC_COPY_ARB 0x88E6
+#define GL_DYNAMIC_DRAW_ARB 0x88E8
+#define GL_DYNAMIC_READ_ARB 0x88E9
+#define GL_DYNAMIC_COPY_ARB 0x88EA
+#endif
+
+#ifndef GL_ARB_occlusion_query
+#define GL_QUERY_COUNTER_BITS_ARB 0x8864
+#define GL_CURRENT_QUERY_ARB 0x8865
+#define GL_QUERY_RESULT_ARB 0x8866
+#define GL_QUERY_RESULT_AVAILABLE_ARB 0x8867
+#define GL_SAMPLES_PASSED_ARB 0x8914
+#endif
+
+#ifndef GL_ARB_shader_objects
+#define GL_PROGRAM_OBJECT_ARB 0x8B40
+#define GL_SHADER_OBJECT_ARB 0x8B48
+#define GL_OBJECT_TYPE_ARB 0x8B4E
+#define GL_OBJECT_SUBTYPE_ARB 0x8B4F
+#define GL_FLOAT_VEC2_ARB 0x8B50
+#define GL_FLOAT_VEC3_ARB 0x8B51
+#define GL_FLOAT_VEC4_ARB 0x8B52
+#define GL_INT_VEC2_ARB 0x8B53
+#define GL_INT_VEC3_ARB 0x8B54
+#define GL_INT_VEC4_ARB 0x8B55
+#define GL_BOOL_ARB 0x8B56
+#define GL_BOOL_VEC2_ARB 0x8B57
+#define GL_BOOL_VEC3_ARB 0x8B58
+#define GL_BOOL_VEC4_ARB 0x8B59
+#define GL_FLOAT_MAT2_ARB 0x8B5A
+#define GL_FLOAT_MAT3_ARB 0x8B5B
+#define GL_FLOAT_MAT4_ARB 0x8B5C
+#define GL_SAMPLER_1D_ARB 0x8B5D
+#define GL_SAMPLER_2D_ARB 0x8B5E
+#define GL_SAMPLER_3D_ARB 0x8B5F
+#define GL_SAMPLER_CUBE_ARB 0x8B60
+#define GL_SAMPLER_1D_SHADOW_ARB 0x8B61
+#define GL_SAMPLER_2D_SHADOW_ARB 0x8B62
+#define GL_SAMPLER_2D_RECT_ARB 0x8B63
+#define GL_SAMPLER_2D_RECT_SHADOW_ARB 0x8B64
+#define GL_OBJECT_DELETE_STATUS_ARB 0x8B80
+#define GL_OBJECT_COMPILE_STATUS_ARB 0x8B81
+#define GL_OBJECT_LINK_STATUS_ARB 0x8B82
+#define GL_OBJECT_VALIDATE_STATUS_ARB 0x8B83
+#define GL_OBJECT_INFO_LOG_LENGTH_ARB 0x8B84
+#define GL_OBJECT_ATTACHED_OBJECTS_ARB 0x8B85
+#define GL_OBJECT_ACTIVE_UNIFORMS_ARB 0x8B86
+#define GL_OBJECT_ACTIVE_UNIFORM_MAX_LENGTH_ARB 0x8B87
+#define GL_OBJECT_SHADER_SOURCE_LENGTH_ARB 0x8B88
+#endif
+
+#ifndef GL_ARB_vertex_shader
+#define GL_VERTEX_SHADER_ARB 0x8B31
+#define GL_MAX_VERTEX_UNIFORM_COMPONENTS_ARB 0x8B4A
+#define GL_MAX_VARYING_FLOATS_ARB 0x8B4B
+#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C
+#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS_ARB 0x8B4D
+#define GL_OBJECT_ACTIVE_ATTRIBUTES_ARB 0x8B89
+#define GL_OBJECT_ACTIVE_ATTRIBUTE_MAX_LENGTH_ARB 0x8B8A
+#endif
+
+#ifndef GL_ARB_fragment_shader
+#define GL_FRAGMENT_SHADER_ARB 0x8B30
+#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS_ARB 0x8B49
+#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B
+#endif
+
+#ifndef GL_ARB_shading_language_100
+#define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C
+#endif
+
+#ifndef GL_ARB_texture_non_power_of_two
+#endif
+
+#ifndef GL_ARB_point_sprite
+#define GL_POINT_SPRITE_ARB 0x8861
+#define GL_COORD_REPLACE_ARB 0x8862
+#endif
+
+#ifndef GL_ARB_fragment_program_shadow
+#endif
+
+#ifndef GL_ARB_draw_buffers
+#define GL_MAX_DRAW_BUFFERS_ARB 0x8824
+#define GL_DRAW_BUFFER0_ARB 0x8825
+#define GL_DRAW_BUFFER1_ARB 0x8826
+#define GL_DRAW_BUFFER2_ARB 0x8827
+#define GL_DRAW_BUFFER3_ARB 0x8828
+#define GL_DRAW_BUFFER4_ARB 0x8829
+#define GL_DRAW_BUFFER5_ARB 0x882A
+#define GL_DRAW_BUFFER6_ARB 0x882B
+#define GL_DRAW_BUFFER7_ARB 0x882C
+#define GL_DRAW_BUFFER8_ARB 0x882D
+#define GL_DRAW_BUFFER9_ARB 0x882E
+#define GL_DRAW_BUFFER10_ARB 0x882F
+#define GL_DRAW_BUFFER11_ARB 0x8830
+#define GL_DRAW_BUFFER12_ARB 0x8831
+#define GL_DRAW_BUFFER13_ARB 0x8832
+#define GL_DRAW_BUFFER14_ARB 0x8833
+#define GL_DRAW_BUFFER15_ARB 0x8834
+#endif
+
+#ifndef GL_ARB_texture_rectangle
+#define GL_TEXTURE_RECTANGLE_ARB 0x84F5
+#define GL_TEXTURE_BINDING_RECTANGLE_ARB 0x84F6
+#define GL_PROXY_TEXTURE_RECTANGLE_ARB 0x84F7
+#define GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB 0x84F8
+#endif
+
+#ifndef GL_ARB_color_buffer_float
+#define GL_RGBA_FLOAT_MODE_ARB 0x8820
+#define GL_CLAMP_VERTEX_COLOR_ARB 0x891A
+#define GL_CLAMP_FRAGMENT_COLOR_ARB 0x891B
+#define GL_CLAMP_READ_COLOR_ARB 0x891C
+#define GL_FIXED_ONLY_ARB 0x891D
+#endif
+
+#ifndef GL_ARB_half_float_pixel
+#define GL_HALF_FLOAT_ARB 0x140B
+#endif
+
+#ifndef GL_ARB_texture_float
+#define GL_TEXTURE_RED_TYPE_ARB 0x8C10
+#define GL_TEXTURE_GREEN_TYPE_ARB 0x8C11
+#define GL_TEXTURE_BLUE_TYPE_ARB 0x8C12
+#define GL_TEXTURE_ALPHA_TYPE_ARB 0x8C13
+#define GL_TEXTURE_LUMINANCE_TYPE_ARB 0x8C14
+#define GL_TEXTURE_INTENSITY_TYPE_ARB 0x8C15
+#define GL_TEXTURE_DEPTH_TYPE_ARB 0x8C16
+#define GL_UNSIGNED_NORMALIZED_ARB 0x8C17
+#define GL_RGBA32F_ARB 0x8814
+#define GL_RGB32F_ARB 0x8815
+#define GL_ALPHA32F_ARB 0x8816
+#define GL_INTENSITY32F_ARB 0x8817
+#define GL_LUMINANCE32F_ARB 0x8818
+#define GL_LUMINANCE_ALPHA32F_ARB 0x8819
+#define GL_RGBA16F_ARB 0x881A
+#define GL_RGB16F_ARB 0x881B
+#define GL_ALPHA16F_ARB 0x881C
+#define GL_INTENSITY16F_ARB 0x881D
+#define GL_LUMINANCE16F_ARB 0x881E
+#define GL_LUMINANCE_ALPHA16F_ARB 0x881F
+#endif
+
+#ifndef GL_ARB_pixel_buffer_object
+#define GL_PIXEL_PACK_BUFFER_ARB 0x88EB
+#define GL_PIXEL_UNPACK_BUFFER_ARB 0x88EC
+#define GL_PIXEL_PACK_BUFFER_BINDING_ARB 0x88ED
+#define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF
+#endif
+
+#ifndef GL_EXT_abgr
+#define GL_ABGR_EXT 0x8000
+#endif
+
+#ifndef GL_EXT_blend_color
+#define GL_CONSTANT_COLOR_EXT 0x8001
+#define GL_ONE_MINUS_CONSTANT_COLOR_EXT 0x8002
+#define GL_CONSTANT_ALPHA_EXT 0x8003
+#define GL_ONE_MINUS_CONSTANT_ALPHA_EXT 0x8004
+#define GL_BLEND_COLOR_EXT 0x8005
+#endif
+
+#ifndef GL_EXT_polygon_offset
+#define GL_POLYGON_OFFSET_EXT 0x8037
+#define GL_POLYGON_OFFSET_FACTOR_EXT 0x8038
+#define GL_POLYGON_OFFSET_BIAS_EXT 0x8039
+#endif
+
+#ifndef GL_EXT_texture
+#define GL_ALPHA4_EXT 0x803B
+#define GL_ALPHA8_EXT 0x803C
+#define GL_ALPHA12_EXT 0x803D
+#define GL_ALPHA16_EXT 0x803E
+#define GL_LUMINANCE4_EXT 0x803F
+#define GL_LUMINANCE8_EXT 0x8040
+#define GL_LUMINANCE12_EXT 0x8041
+#define GL_LUMINANCE16_EXT 0x8042
+#define GL_LUMINANCE4_ALPHA4_EXT 0x8043
+#define GL_LUMINANCE6_ALPHA2_EXT 0x8044
+#define GL_LUMINANCE8_ALPHA8_EXT 0x8045
+#define GL_LUMINANCE12_ALPHA4_EXT 0x8046
+#define GL_LUMINANCE12_ALPHA12_EXT 0x8047
+#define GL_LUMINANCE16_ALPHA16_EXT 0x8048
+#define GL_INTENSITY_EXT 0x8049
+#define GL_INTENSITY4_EXT 0x804A
+#define GL_INTENSITY8_EXT 0x804B
+#define GL_INTENSITY12_EXT 0x804C
+#define GL_INTENSITY16_EXT 0x804D
+#define GL_RGB2_EXT 0x804E
+#define GL_RGB4_EXT 0x804F
+#define GL_RGB5_EXT 0x8050
+#define GL_RGB8_EXT 0x8051
+#define GL_RGB10_EXT 0x8052
+#define GL_RGB12_EXT 0x8053
+#define GL_RGB16_EXT 0x8054
+#define GL_RGBA2_EXT 0x8055
+#define GL_RGBA4_EXT 0x8056
+#define GL_RGB5_A1_EXT 0x8057
+#define GL_RGBA8_EXT 0x8058
+#define GL_RGB10_A2_EXT 0x8059
+#define GL_RGBA12_EXT 0x805A
+#define GL_RGBA16_EXT 0x805B
+#define GL_TEXTURE_RED_SIZE_EXT 0x805C
+#define GL_TEXTURE_GREEN_SIZE_EXT 0x805D
+#define GL_TEXTURE_BLUE_SIZE_EXT 0x805E
+#define GL_TEXTURE_ALPHA_SIZE_EXT 0x805F
+#define GL_TEXTURE_LUMINANCE_SIZE_EXT 0x8060
+#define GL_TEXTURE_INTENSITY_SIZE_EXT 0x8061
+#define GL_REPLACE_EXT 0x8062
+#define GL_PROXY_TEXTURE_1D_EXT 0x8063
+#define GL_PROXY_TEXTURE_2D_EXT 0x8064
+#define GL_TEXTURE_TOO_LARGE_EXT 0x8065
+#endif
+
+#ifndef GL_EXT_texture3D
+#define GL_PACK_SKIP_IMAGES_EXT 0x806B
+#define GL_PACK_IMAGE_HEIGHT_EXT 0x806C
+#define GL_UNPACK_SKIP_IMAGES_EXT 0x806D
+#define GL_UNPACK_IMAGE_HEIGHT_EXT 0x806E
+#define GL_TEXTURE_3D_EXT 0x806F
+#define GL_PROXY_TEXTURE_3D_EXT 0x8070
+#define GL_TEXTURE_DEPTH_EXT 0x8071
+#define GL_TEXTURE_WRAP_R_EXT 0x8072
+#define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073
+#endif
+
+#ifndef GL_SGIS_texture_filter4
+#define GL_FILTER4_SGIS 0x8146
+#define GL_TEXTURE_FILTER4_SIZE_SGIS 0x8147
+#endif
+
+#ifndef GL_EXT_subtexture
+#endif
+
+#ifndef GL_EXT_copy_texture
+#endif
+
+#ifndef GL_EXT_histogram
+#define GL_HISTOGRAM_EXT 0x8024
+#define GL_PROXY_HISTOGRAM_EXT 0x8025
+#define GL_HISTOGRAM_WIDTH_EXT 0x8026
+#define GL_HISTOGRAM_FORMAT_EXT 0x8027
+#define GL_HISTOGRAM_RED_SIZE_EXT 0x8028
+#define GL_HISTOGRAM_GREEN_SIZE_EXT 0x8029
+#define GL_HISTOGRAM_BLUE_SIZE_EXT 0x802A
+#define GL_HISTOGRAM_ALPHA_SIZE_EXT 0x802B
+#define GL_HISTOGRAM_LUMINANCE_SIZE_EXT 0x802C
+#define GL_HISTOGRAM_SINK_EXT 0x802D
+#define GL_MINMAX_EXT 0x802E
+#define GL_MINMAX_FORMAT_EXT 0x802F
+#define GL_MINMAX_SINK_EXT 0x8030
+#define GL_TABLE_TOO_LARGE_EXT 0x8031
+#endif
+
+#ifndef GL_EXT_convolution
+#define GL_CONVOLUTION_1D_EXT 0x8010
+#define GL_CONVOLUTION_2D_EXT 0x8011
+#define GL_SEPARABLE_2D_EXT 0x8012
+#define GL_CONVOLUTION_BORDER_MODE_EXT 0x8013
+#define GL_CONVOLUTION_FILTER_SCALE_EXT 0x8014
+#define GL_CONVOLUTION_FILTER_BIAS_EXT 0x8015
+#define GL_REDUCE_EXT 0x8016
+#define GL_CONVOLUTION_FORMAT_EXT 0x8017
+#define GL_CONVOLUTION_WIDTH_EXT 0x8018
+#define GL_CONVOLUTION_HEIGHT_EXT 0x8019
+#define GL_MAX_CONVOLUTION_WIDTH_EXT 0x801A
+#define GL_MAX_CONVOLUTION_HEIGHT_EXT 0x801B
+#define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C
+#define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D
+#define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E
+#define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F
+#define GL_POST_CONVOLUTION_RED_BIAS_EXT 0x8020
+#define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021
+#define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022
+#define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023
+#endif
+
+#ifndef GL_SGI_color_matrix
+#define GL_COLOR_MATRIX_SGI 0x80B1
+#define GL_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B2
+#define GL_MAX_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B3
+#define GL_POST_COLOR_MATRIX_RED_SCALE_SGI 0x80B4
+#define GL_POST_COLOR_MATRIX_GREEN_SCALE_SGI 0x80B5
+#define GL_POST_COLOR_MATRIX_BLUE_SCALE_SGI 0x80B6
+#define GL_POST_COLOR_MATRIX_ALPHA_SCALE_SGI 0x80B7
+#define GL_POST_COLOR_MATRIX_RED_BIAS_SGI 0x80B8
+#define GL_POST_COLOR_MATRIX_GREEN_BIAS_SGI 0x80B9
+#define GL_POST_COLOR_MATRIX_BLUE_BIAS_SGI 0x80BA
+#define GL_POST_COLOR_MATRIX_ALPHA_BIAS_SGI 0x80BB
+#endif
+
+#ifndef GL_SGI_color_table
+#define GL_COLOR_TABLE_SGI 0x80D0
+#define GL_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D1
+#define GL_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D2
+#define GL_PROXY_COLOR_TABLE_SGI 0x80D3
+#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D4
+#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D5
+#define GL_COLOR_TABLE_SCALE_SGI 0x80D6
+#define GL_COLOR_TABLE_BIAS_SGI 0x80D7
+#define GL_COLOR_TABLE_FORMAT_SGI 0x80D8
+#define GL_COLOR_TABLE_WIDTH_SGI 0x80D9
+#define GL_COLOR_TABLE_RED_SIZE_SGI 0x80DA
+#define GL_COLOR_TABLE_GREEN_SIZE_SGI 0x80DB
+#define GL_COLOR_TABLE_BLUE_SIZE_SGI 0x80DC
+#define GL_COLOR_TABLE_ALPHA_SIZE_SGI 0x80DD
+#define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE
+#define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF
+#endif
+
+#ifndef GL_SGIS_pixel_texture
+#define GL_PIXEL_TEXTURE_SGIS 0x8353
+#define GL_PIXEL_FRAGMENT_RGB_SOURCE_SGIS 0x8354
+#define GL_PIXEL_FRAGMENT_ALPHA_SOURCE_SGIS 0x8355
+#define GL_PIXEL_GROUP_COLOR_SGIS 0x8356
+#endif
+
+#ifndef GL_SGIX_pixel_texture
+#define GL_PIXEL_TEX_GEN_SGIX 0x8139
+#define GL_PIXEL_TEX_GEN_MODE_SGIX 0x832B
+#endif
+
+#ifndef GL_SGIS_texture4D
+#define GL_PACK_SKIP_VOLUMES_SGIS 0x8130
+#define GL_PACK_IMAGE_DEPTH_SGIS 0x8131
+#define GL_UNPACK_SKIP_VOLUMES_SGIS 0x8132
+#define GL_UNPACK_IMAGE_DEPTH_SGIS 0x8133
+#define GL_TEXTURE_4D_SGIS 0x8134
+#define GL_PROXY_TEXTURE_4D_SGIS 0x8135
+#define GL_TEXTURE_4DSIZE_SGIS 0x8136
+#define GL_TEXTURE_WRAP_Q_SGIS 0x8137
+#define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138
+#define GL_TEXTURE_4D_BINDING_SGIS 0x814F
+#endif
+
+#ifndef GL_SGI_texture_color_table
+#define GL_TEXTURE_COLOR_TABLE_SGI 0x80BC
+#define GL_PROXY_TEXTURE_COLOR_TABLE_SGI 0x80BD
+#endif
+
+#ifndef GL_EXT_cmyka
+#define GL_CMYK_EXT 0x800C
+#define GL_CMYKA_EXT 0x800D
+#define GL_PACK_CMYK_HINT_EXT 0x800E
+#define GL_UNPACK_CMYK_HINT_EXT 0x800F
+#endif
+
+#ifndef GL_EXT_texture_object
+#define GL_TEXTURE_PRIORITY_EXT 0x8066
+#define GL_TEXTURE_RESIDENT_EXT 0x8067
+#define GL_TEXTURE_1D_BINDING_EXT 0x8068
+#define GL_TEXTURE_2D_BINDING_EXT 0x8069
+#define GL_TEXTURE_3D_BINDING_EXT 0x806A
+#endif
+
+#ifndef GL_SGIS_detail_texture
+#define GL_DETAIL_TEXTURE_2D_SGIS 0x8095
+#define GL_DETAIL_TEXTURE_2D_BINDING_SGIS 0x8096
+#define GL_LINEAR_DETAIL_SGIS 0x8097
+#define GL_LINEAR_DETAIL_ALPHA_SGIS 0x8098
+#define GL_LINEAR_DETAIL_COLOR_SGIS 0x8099
+#define GL_DETAIL_TEXTURE_LEVEL_SGIS 0x809A
+#define GL_DETAIL_TEXTURE_MODE_SGIS 0x809B
+#define GL_DETAIL_TEXTURE_FUNC_POINTS_SGIS 0x809C
+#endif
+
+#ifndef GL_SGIS_sharpen_texture
+#define GL_LINEAR_SHARPEN_SGIS 0x80AD
+#define GL_LINEAR_SHARPEN_ALPHA_SGIS 0x80AE
+#define GL_LINEAR_SHARPEN_COLOR_SGIS 0x80AF
+#define GL_SHARPEN_TEXTURE_FUNC_POINTS_SGIS 0x80B0
+#endif
+
+#ifndef GL_EXT_packed_pixels
+#define GL_UNSIGNED_BYTE_3_3_2_EXT 0x8032
+#define GL_UNSIGNED_SHORT_4_4_4_4_EXT 0x8033
+#define GL_UNSIGNED_SHORT_5_5_5_1_EXT 0x8034
+#define GL_UNSIGNED_INT_8_8_8_8_EXT 0x8035
+#define GL_UNSIGNED_INT_10_10_10_2_EXT 0x8036
+#endif
+
+#ifndef GL_SGIS_texture_lod
+#define GL_TEXTURE_MIN_LOD_SGIS 0x813A
+#define GL_TEXTURE_MAX_LOD_SGIS 0x813B
+#define GL_TEXTURE_BASE_LEVEL_SGIS 0x813C
+#define GL_TEXTURE_MAX_LEVEL_SGIS 0x813D
+#endif
+
+#ifndef GL_SGIS_multisample
+#define GL_MULTISAMPLE_SGIS 0x809D
+#define GL_SAMPLE_ALPHA_TO_MASK_SGIS 0x809E
+#define GL_SAMPLE_ALPHA_TO_ONE_SGIS 0x809F
+#define GL_SAMPLE_MASK_SGIS 0x80A0
+#define GL_1PASS_SGIS 0x80A1
+#define GL_2PASS_0_SGIS 0x80A2
+#define GL_2PASS_1_SGIS 0x80A3
+#define GL_4PASS_0_SGIS 0x80A4
+#define GL_4PASS_1_SGIS 0x80A5
+#define GL_4PASS_2_SGIS 0x80A6
+#define GL_4PASS_3_SGIS 0x80A7
+#define GL_SAMPLE_BUFFERS_SGIS 0x80A8
+#define GL_SAMPLES_SGIS 0x80A9
+#define GL_SAMPLE_MASK_VALUE_SGIS 0x80AA
+#define GL_SAMPLE_MASK_INVERT_SGIS 0x80AB
+#define GL_SAMPLE_PATTERN_SGIS 0x80AC
+#endif
+
+#ifndef GL_EXT_rescale_normal
+#define GL_RESCALE_NORMAL_EXT 0x803A
+#endif
+
+#ifndef GL_EXT_vertex_array
+#define GL_VERTEX_ARRAY_EXT 0x8074
+#define GL_NORMAL_ARRAY_EXT 0x8075
+#define GL_COLOR_ARRAY_EXT 0x8076
+#define GL_INDEX_ARRAY_EXT 0x8077
+#define GL_TEXTURE_COORD_ARRAY_EXT 0x8078
+#define GL_EDGE_FLAG_ARRAY_EXT 0x8079
+#define GL_VERTEX_ARRAY_SIZE_EXT 0x807A
+#define GL_VERTEX_ARRAY_TYPE_EXT 0x807B
+#define GL_VERTEX_ARRAY_STRIDE_EXT 0x807C
+#define GL_VERTEX_ARRAY_COUNT_EXT 0x807D
+#define GL_NORMAL_ARRAY_TYPE_EXT 0x807E
+#define GL_NORMAL_ARRAY_STRIDE_EXT 0x807F
+#define GL_NORMAL_ARRAY_COUNT_EXT 0x8080
+#define GL_COLOR_ARRAY_SIZE_EXT 0x8081
+#define GL_COLOR_ARRAY_TYPE_EXT 0x8082
+#define GL_COLOR_ARRAY_STRIDE_EXT 0x8083
+#define GL_COLOR_ARRAY_COUNT_EXT 0x8084
+#define GL_INDEX_ARRAY_TYPE_EXT 0x8085
+#define GL_INDEX_ARRAY_STRIDE_EXT 0x8086
+#define GL_INDEX_ARRAY_COUNT_EXT 0x8087
+#define GL_TEXTURE_COORD_ARRAY_SIZE_EXT 0x8088
+#define GL_TEXTURE_COORD_ARRAY_TYPE_EXT 0x8089
+#define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A
+#define GL_TEXTURE_COORD_ARRAY_COUNT_EXT 0x808B
+#define GL_EDGE_FLAG_ARRAY_STRIDE_EXT 0x808C
+#define GL_EDGE_FLAG_ARRAY_COUNT_EXT 0x808D
+#define GL_VERTEX_ARRAY_POINTER_EXT 0x808E
+#define GL_NORMAL_ARRAY_POINTER_EXT 0x808F
+#define GL_COLOR_ARRAY_POINTER_EXT 0x8090
+#define GL_INDEX_ARRAY_POINTER_EXT 0x8091
+#define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092
+#define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093
+#endif
+
+#ifndef GL_EXT_misc_attribute
+#endif
+
+#ifndef GL_SGIS_generate_mipmap
+#define GL_GENERATE_MIPMAP_SGIS 0x8191
+#define GL_GENERATE_MIPMAP_HINT_SGIS 0x8192
+#endif
+
+#ifndef GL_SGIX_clipmap
+#define GL_LINEAR_CLIPMAP_LINEAR_SGIX 0x8170
+#define GL_TEXTURE_CLIPMAP_CENTER_SGIX 0x8171
+#define GL_TEXTURE_CLIPMAP_FRAME_SGIX 0x8172
+#define GL_TEXTURE_CLIPMAP_OFFSET_SGIX 0x8173
+#define GL_TEXTURE_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8174
+#define GL_TEXTURE_CLIPMAP_LOD_OFFSET_SGIX 0x8175
+#define GL_TEXTURE_CLIPMAP_DEPTH_SGIX 0x8176
+#define GL_MAX_CLIPMAP_DEPTH_SGIX 0x8177
+#define GL_MAX_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8178
+#define GL_NEAREST_CLIPMAP_NEAREST_SGIX 0x844D
+#define GL_NEAREST_CLIPMAP_LINEAR_SGIX 0x844E
+#define GL_LINEAR_CLIPMAP_NEAREST_SGIX 0x844F
+#endif
+
+#ifndef GL_SGIX_shadow
+#define GL_TEXTURE_COMPARE_SGIX 0x819A
+#define GL_TEXTURE_COMPARE_OPERATOR_SGIX 0x819B
+#define GL_TEXTURE_LEQUAL_R_SGIX 0x819C
+#define GL_TEXTURE_GEQUAL_R_SGIX 0x819D
+#endif
+
+#ifndef GL_SGIS_texture_edge_clamp
+#define GL_CLAMP_TO_EDGE_SGIS 0x812F
+#endif
+
+#ifndef GL_SGIS_texture_border_clamp
+#define GL_CLAMP_TO_BORDER_SGIS 0x812D
+#endif
+
+#ifndef GL_EXT_blend_minmax
+#define GL_FUNC_ADD_EXT 0x8006
+#define GL_MIN_EXT 0x8007
+#define GL_MAX_EXT 0x8008
+#define GL_BLEND_EQUATION_EXT 0x8009
+#endif
+
+#ifndef GL_EXT_blend_subtract
+#define GL_FUNC_SUBTRACT_EXT 0x800A
+#define GL_FUNC_REVERSE_SUBTRACT_EXT 0x800B
+#endif
+
+#ifndef GL_EXT_blend_logic_op
+#endif
+
+#ifndef GL_SGIX_interlace
+#define GL_INTERLACE_SGIX 0x8094
+#endif
+
+#ifndef GL_SGIX_pixel_tiles
+#define GL_PIXEL_TILE_BEST_ALIGNMENT_SGIX 0x813E
+#define GL_PIXEL_TILE_CACHE_INCREMENT_SGIX 0x813F
+#define GL_PIXEL_TILE_WIDTH_SGIX 0x8140
+#define GL_PIXEL_TILE_HEIGHT_SGIX 0x8141
+#define GL_PIXEL_TILE_GRID_WIDTH_SGIX 0x8142
+#define GL_PIXEL_TILE_GRID_HEIGHT_SGIX 0x8143
+#define GL_PIXEL_TILE_GRID_DEPTH_SGIX 0x8144
+#define GL_PIXEL_TILE_CACHE_SIZE_SGIX 0x8145
+#endif
+
+#ifndef GL_SGIS_texture_select
+#define GL_DUAL_ALPHA4_SGIS 0x8110
+#define GL_DUAL_ALPHA8_SGIS 0x8111
+#define GL_DUAL_ALPHA12_SGIS 0x8112
+#define GL_DUAL_ALPHA16_SGIS 0x8113
+#define GL_DUAL_LUMINANCE4_SGIS 0x8114
+#define GL_DUAL_LUMINANCE8_SGIS 0x8115
+#define GL_DUAL_LUMINANCE12_SGIS 0x8116
+#define GL_DUAL_LUMINANCE16_SGIS 0x8117
+#define GL_DUAL_INTENSITY4_SGIS 0x8118
+#define GL_DUAL_INTENSITY8_SGIS 0x8119
+#define GL_DUAL_INTENSITY12_SGIS 0x811A
+#define GL_DUAL_INTENSITY16_SGIS 0x811B
+#define GL_DUAL_LUMINANCE_ALPHA4_SGIS 0x811C
+#define GL_DUAL_LUMINANCE_ALPHA8_SGIS 0x811D
+#define GL_QUAD_ALPHA4_SGIS 0x811E
+#define GL_QUAD_ALPHA8_SGIS 0x811F
+#define GL_QUAD_LUMINANCE4_SGIS 0x8120
+#define GL_QUAD_LUMINANCE8_SGIS 0x8121
+#define GL_QUAD_INTENSITY4_SGIS 0x8122
+#define GL_QUAD_INTENSITY8_SGIS 0x8123
+#define GL_DUAL_TEXTURE_SELECT_SGIS 0x8124
+#define GL_QUAD_TEXTURE_SELECT_SGIS 0x8125
+#endif
+
+#ifndef GL_SGIX_sprite
+#define GL_SPRITE_SGIX 0x8148
+#define GL_SPRITE_MODE_SGIX 0x8149
+#define GL_SPRITE_AXIS_SGIX 0x814A
+#define GL_SPRITE_TRANSLATION_SGIX 0x814B
+#define GL_SPRITE_AXIAL_SGIX 0x814C
+#define GL_SPRITE_OBJECT_ALIGNED_SGIX 0x814D
+#define GL_SPRITE_EYE_ALIGNED_SGIX 0x814E
+#endif
+
+#ifndef GL_SGIX_texture_multi_buffer
+#define GL_TEXTURE_MULTI_BUFFER_HINT_SGIX 0x812E
+#endif
+
+#ifndef GL_EXT_point_parameters
+#define GL_POINT_SIZE_MIN_EXT 0x8126
+#define GL_POINT_SIZE_MAX_EXT 0x8127
+#define GL_POINT_FADE_THRESHOLD_SIZE_EXT 0x8128
+#define GL_DISTANCE_ATTENUATION_EXT 0x8129
+#endif
+
+#ifndef GL_SGIS_point_parameters
+#define GL_POINT_SIZE_MIN_SGIS 0x8126
+#define GL_POINT_SIZE_MAX_SGIS 0x8127
+#define GL_POINT_FADE_THRESHOLD_SIZE_SGIS 0x8128
+#define GL_DISTANCE_ATTENUATION_SGIS 0x8129
+#endif
+
+#ifndef GL_SGIX_instruments
+#define GL_INSTRUMENT_BUFFER_POINTER_SGIX 0x8180
+#define GL_INSTRUMENT_MEASUREMENTS_SGIX 0x8181
+#endif
+
+#ifndef GL_SGIX_texture_scale_bias
+#define GL_POST_TEXTURE_FILTER_BIAS_SGIX 0x8179
+#define GL_POST_TEXTURE_FILTER_SCALE_SGIX 0x817A
+#define GL_POST_TEXTURE_FILTER_BIAS_RANGE_SGIX 0x817B
+#define GL_POST_TEXTURE_FILTER_SCALE_RANGE_SGIX 0x817C
+#endif
+
+#ifndef GL_SGIX_framezoom
+#define GL_FRAMEZOOM_SGIX 0x818B
+#define GL_FRAMEZOOM_FACTOR_SGIX 0x818C
+#define GL_MAX_FRAMEZOOM_FACTOR_SGIX 0x818D
+#endif
+
+#ifndef GL_SGIX_tag_sample_buffer
+#endif
+
+#ifndef GL_FfdMaskSGIX
+#define GL_TEXTURE_DEFORMATION_BIT_SGIX 0x00000001
+#define GL_GEOMETRY_DEFORMATION_BIT_SGIX 0x00000002
+#endif
+
+#ifndef GL_SGIX_polynomial_ffd
+#define GL_GEOMETRY_DEFORMATION_SGIX 0x8194
+#define GL_TEXTURE_DEFORMATION_SGIX 0x8195
+#define GL_DEFORMATIONS_MASK_SGIX 0x8196
+#define GL_MAX_DEFORMATION_ORDER_SGIX 0x8197
+#endif
+
+#ifndef GL_SGIX_reference_plane
+#define GL_REFERENCE_PLANE_SGIX 0x817D
+#define GL_REFERENCE_PLANE_EQUATION_SGIX 0x817E
+#endif
+
+#ifndef GL_SGIX_flush_raster
+#endif
+
+#ifndef GL_SGIX_depth_texture
+#define GL_DEPTH_COMPONENT16_SGIX 0x81A5
+#define GL_DEPTH_COMPONENT24_SGIX 0x81A6
+#define GL_DEPTH_COMPONENT32_SGIX 0x81A7
+#endif
+
+#ifndef GL_SGIS_fog_function
+#define GL_FOG_FUNC_SGIS 0x812A
+#define GL_FOG_FUNC_POINTS_SGIS 0x812B
+#define GL_MAX_FOG_FUNC_POINTS_SGIS 0x812C
+#endif
+
+#ifndef GL_SGIX_fog_offset
+#define GL_FOG_OFFSET_SGIX 0x8198
+#define GL_FOG_OFFSET_VALUE_SGIX 0x8199
+#endif
+
+#ifndef GL_HP_image_transform
+#define GL_IMAGE_SCALE_X_HP 0x8155
+#define GL_IMAGE_SCALE_Y_HP 0x8156
+#define GL_IMAGE_TRANSLATE_X_HP 0x8157
+#define GL_IMAGE_TRANSLATE_Y_HP 0x8158
+#define GL_IMAGE_ROTATE_ANGLE_HP 0x8159
+#define GL_IMAGE_ROTATE_ORIGIN_X_HP 0x815A
+#define GL_IMAGE_ROTATE_ORIGIN_Y_HP 0x815B
+#define GL_IMAGE_MAG_FILTER_HP 0x815C
+#define GL_IMAGE_MIN_FILTER_HP 0x815D
+#define GL_IMAGE_CUBIC_WEIGHT_HP 0x815E
+#define GL_CUBIC_HP 0x815F
+#define GL_AVERAGE_HP 0x8160
+#define GL_IMAGE_TRANSFORM_2D_HP 0x8161
+#define GL_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8162
+#define GL_PROXY_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8163
+#endif
+
+#ifndef GL_HP_convolution_border_modes
+#define GL_IGNORE_BORDER_HP 0x8150
+#define GL_CONSTANT_BORDER_HP 0x8151
+#define GL_REPLICATE_BORDER_HP 0x8153
+#define GL_CONVOLUTION_BORDER_COLOR_HP 0x8154
+#endif
+
+#ifndef GL_INGR_palette_buffer
+#endif
+
+#ifndef GL_SGIX_texture_add_env
+#define GL_TEXTURE_ENV_BIAS_SGIX 0x80BE
+#endif
+
+#ifndef GL_EXT_color_subtable
+#endif
+
+#ifndef GL_PGI_vertex_hints
+#define GL_VERTEX_DATA_HINT_PGI 0x1A22A
+#define GL_VERTEX_CONSISTENT_HINT_PGI 0x1A22B
+#define GL_MATERIAL_SIDE_HINT_PGI 0x1A22C
+#define GL_MAX_VERTEX_HINT_PGI 0x1A22D
+#define GL_COLOR3_BIT_PGI 0x00010000
+#define GL_COLOR4_BIT_PGI 0x00020000
+#define GL_EDGEFLAG_BIT_PGI 0x00040000
+#define GL_INDEX_BIT_PGI 0x00080000
+#define GL_MAT_AMBIENT_BIT_PGI 0x00100000
+#define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000
+#define GL_MAT_DIFFUSE_BIT_PGI 0x00400000
+#define GL_MAT_EMISSION_BIT_PGI 0x00800000
+#define GL_MAT_COLOR_INDEXES_BIT_PGI 0x01000000
+#define GL_MAT_SHININESS_BIT_PGI 0x02000000
+#define GL_MAT_SPECULAR_BIT_PGI 0x04000000
+#define GL_NORMAL_BIT_PGI 0x08000000
+#define GL_TEXCOORD1_BIT_PGI 0x10000000
+#define GL_TEXCOORD2_BIT_PGI 0x20000000
+#define GL_TEXCOORD3_BIT_PGI 0x40000000
+#define GL_TEXCOORD4_BIT_PGI 0x80000000
+#define GL_VERTEX23_BIT_PGI 0x00000004
+#define GL_VERTEX4_BIT_PGI 0x00000008
+#endif
+
+#ifndef GL_PGI_misc_hints
+#define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8
+#define GL_CONSERVE_MEMORY_HINT_PGI 0x1A1FD
+#define GL_RECLAIM_MEMORY_HINT_PGI 0x1A1FE
+#define GL_NATIVE_GRAPHICS_HANDLE_PGI 0x1A202
+#define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 0x1A203
+#define GL_NATIVE_GRAPHICS_END_HINT_PGI 0x1A204
+#define GL_ALWAYS_FAST_HINT_PGI 0x1A20C
+#define GL_ALWAYS_SOFT_HINT_PGI 0x1A20D
+#define GL_ALLOW_DRAW_OBJ_HINT_PGI 0x1A20E
+#define GL_ALLOW_DRAW_WIN_HINT_PGI 0x1A20F
+#define GL_ALLOW_DRAW_FRG_HINT_PGI 0x1A210
+#define GL_ALLOW_DRAW_MEM_HINT_PGI 0x1A211
+#define GL_STRICT_DEPTHFUNC_HINT_PGI 0x1A216
+#define GL_STRICT_LIGHTING_HINT_PGI 0x1A217
+#define GL_STRICT_SCISSOR_HINT_PGI 0x1A218
+#define GL_FULL_STIPPLE_HINT_PGI 0x1A219
+#define GL_CLIP_NEAR_HINT_PGI 0x1A220
+#define GL_CLIP_FAR_HINT_PGI 0x1A221
+#define GL_WIDE_LINE_HINT_PGI 0x1A222
+#define GL_BACK_NORMALS_HINT_PGI 0x1A223
+#endif
+
+#ifndef GL_EXT_paletted_texture
+#define GL_COLOR_INDEX1_EXT 0x80E2
+#define GL_COLOR_INDEX2_EXT 0x80E3
+#define GL_COLOR_INDEX4_EXT 0x80E4
+#define GL_COLOR_INDEX8_EXT 0x80E5
+#define GL_COLOR_INDEX12_EXT 0x80E6
+#define GL_COLOR_INDEX16_EXT 0x80E7
+#define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED
+#endif
+
+#ifndef GL_EXT_clip_volume_hint
+#define GL_CLIP_VOLUME_CLIPPING_HINT_EXT 0x80F0
+#endif
+
+#ifndef GL_SGIX_list_priority
+#define GL_LIST_PRIORITY_SGIX 0x8182
+#endif
+
+#ifndef GL_SGIX_ir_instrument1
+#define GL_IR_INSTRUMENT1_SGIX 0x817F
+#endif
+
+#ifndef GL_SGIX_calligraphic_fragment
+#define GL_CALLIGRAPHIC_FRAGMENT_SGIX 0x8183
+#endif
+
+#ifndef GL_SGIX_texture_lod_bias
+#define GL_TEXTURE_LOD_BIAS_S_SGIX 0x818E
+#define GL_TEXTURE_LOD_BIAS_T_SGIX 0x818F
+#define GL_TEXTURE_LOD_BIAS_R_SGIX 0x8190
+#endif
+
+#ifndef GL_SGIX_shadow_ambient
+#define GL_SHADOW_AMBIENT_SGIX 0x80BF
+#endif
+
+#ifndef GL_EXT_index_texture
+#endif
+
+#ifndef GL_EXT_index_material
+#define GL_INDEX_MATERIAL_EXT 0x81B8
+#define GL_INDEX_MATERIAL_PARAMETER_EXT 0x81B9
+#define GL_INDEX_MATERIAL_FACE_EXT 0x81BA
+#endif
+
+#ifndef GL_EXT_index_func
+#define GL_INDEX_TEST_EXT 0x81B5
+#define GL_INDEX_TEST_FUNC_EXT 0x81B6
+#define GL_INDEX_TEST_REF_EXT 0x81B7
+#endif
+
+#ifndef GL_EXT_index_array_formats
+#define GL_IUI_V2F_EXT 0x81AD
+#define GL_IUI_V3F_EXT 0x81AE
+#define GL_IUI_N3F_V2F_EXT 0x81AF
+#define GL_IUI_N3F_V3F_EXT 0x81B0
+#define GL_T2F_IUI_V2F_EXT 0x81B1
+#define GL_T2F_IUI_V3F_EXT 0x81B2
+#define GL_T2F_IUI_N3F_V2F_EXT 0x81B3
+#define GL_T2F_IUI_N3F_V3F_EXT 0x81B4
+#endif
+
+#ifndef GL_EXT_compiled_vertex_array
+#define GL_ARRAY_ELEMENT_LOCK_FIRST_EXT 0x81A8
+#define GL_ARRAY_ELEMENT_LOCK_COUNT_EXT 0x81A9
+#endif
+
+#ifndef GL_EXT_cull_vertex
+#define GL_CULL_VERTEX_EXT 0x81AA
+#define GL_CULL_VERTEX_EYE_POSITION_EXT 0x81AB
+#define GL_CULL_VERTEX_OBJECT_POSITION_EXT 0x81AC
+#endif
+
+#ifndef GL_SGIX_ycrcb
+#define GL_YCRCB_422_SGIX 0x81BB
+#define GL_YCRCB_444_SGIX 0x81BC
+#endif
+
+#ifndef GL_SGIX_fragment_lighting
+#define GL_FRAGMENT_LIGHTING_SGIX 0x8400
+#define GL_FRAGMENT_COLOR_MATERIAL_SGIX 0x8401
+#define GL_FRAGMENT_COLOR_MATERIAL_FACE_SGIX 0x8402
+#define GL_FRAGMENT_COLOR_MATERIAL_PARAMETER_SGIX 0x8403
+#define GL_MAX_FRAGMENT_LIGHTS_SGIX 0x8404
+#define GL_MAX_ACTIVE_LIGHTS_SGIX 0x8405
+#define GL_CURRENT_RASTER_NORMAL_SGIX 0x8406
+#define GL_LIGHT_ENV_MODE_SGIX 0x8407
+#define GL_FRAGMENT_LIGHT_MODEL_LOCAL_VIEWER_SGIX 0x8408
+#define GL_FRAGMENT_LIGHT_MODEL_TWO_SIDE_SGIX 0x8409
+#define GL_FRAGMENT_LIGHT_MODEL_AMBIENT_SGIX 0x840A
+#define GL_FRAGMENT_LIGHT_MODEL_NORMAL_INTERPOLATION_SGIX 0x840B
+#define GL_FRAGMENT_LIGHT0_SGIX 0x840C
+#define GL_FRAGMENT_LIGHT1_SGIX 0x840D
+#define GL_FRAGMENT_LIGHT2_SGIX 0x840E
+#define GL_FRAGMENT_LIGHT3_SGIX 0x840F
+#define GL_FRAGMENT_LIGHT4_SGIX 0x8410
+#define GL_FRAGMENT_LIGHT5_SGIX 0x8411
+#define GL_FRAGMENT_LIGHT6_SGIX 0x8412
+#define GL_FRAGMENT_LIGHT7_SGIX 0x8413
+#endif
+
+#ifndef GL_IBM_rasterpos_clip
+#define GL_RASTER_POSITION_UNCLIPPED_IBM 0x19262
+#endif
+
+#ifndef GL_HP_texture_lighting
+#define GL_TEXTURE_LIGHTING_MODE_HP 0x8167
+#define GL_TEXTURE_POST_SPECULAR_HP 0x8168
+#define GL_TEXTURE_PRE_SPECULAR_HP 0x8169
+#endif
+
+#ifndef GL_EXT_draw_range_elements
+#define GL_MAX_ELEMENTS_VERTICES_EXT 0x80E8
+#define GL_MAX_ELEMENTS_INDICES_EXT 0x80E9
+#endif
+
+#ifndef GL_WIN_phong_shading
+#define GL_PHONG_WIN 0x80EA
+#define GL_PHONG_HINT_WIN 0x80EB
+#endif
+
+#ifndef GL_WIN_specular_fog
+#define GL_FOG_SPECULAR_TEXTURE_WIN 0x80EC
+#endif
+
+#ifndef GL_EXT_light_texture
+#define GL_FRAGMENT_MATERIAL_EXT 0x8349
+#define GL_FRAGMENT_NORMAL_EXT 0x834A
+#define GL_FRAGMENT_COLOR_EXT 0x834C
+#define GL_ATTENUATION_EXT 0x834D
+#define GL_SHADOW_ATTENUATION_EXT 0x834E
+#define GL_TEXTURE_APPLICATION_MODE_EXT 0x834F
+#define GL_TEXTURE_LIGHT_EXT 0x8350
+#define GL_TEXTURE_MATERIAL_FACE_EXT 0x8351
+#define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352
+/* reuse GL_FRAGMENT_DEPTH_EXT */
+#endif
+
+#ifndef GL_SGIX_blend_alpha_minmax
+#define GL_ALPHA_MIN_SGIX 0x8320
+#define GL_ALPHA_MAX_SGIX 0x8321
+#endif
+
+#ifndef GL_SGIX_impact_pixel_texture
+#define GL_PIXEL_TEX_GEN_Q_CEILING_SGIX 0x8184
+#define GL_PIXEL_TEX_GEN_Q_ROUND_SGIX 0x8185
+#define GL_PIXEL_TEX_GEN_Q_FLOOR_SGIX 0x8186
+#define GL_PIXEL_TEX_GEN_ALPHA_REPLACE_SGIX 0x8187
+#define GL_PIXEL_TEX_GEN_ALPHA_NO_REPLACE_SGIX 0x8188
+#define GL_PIXEL_TEX_GEN_ALPHA_LS_SGIX 0x8189
+#define GL_PIXEL_TEX_GEN_ALPHA_MS_SGIX 0x818A
+#endif
+
+#ifndef GL_EXT_bgra
+#define GL_BGR_EXT 0x80E0
+#define GL_BGRA_EXT 0x80E1
+#endif
+
+#ifndef GL_SGIX_async
+#define GL_ASYNC_MARKER_SGIX 0x8329
+#endif
+
+#ifndef GL_SGIX_async_pixel
+#define GL_ASYNC_TEX_IMAGE_SGIX 0x835C
+#define GL_ASYNC_DRAW_PIXELS_SGIX 0x835D
+#define GL_ASYNC_READ_PIXELS_SGIX 0x835E
+#define GL_MAX_ASYNC_TEX_IMAGE_SGIX 0x835F
+#define GL_MAX_ASYNC_DRAW_PIXELS_SGIX 0x8360
+#define GL_MAX_ASYNC_READ_PIXELS_SGIX 0x8361
+#endif
+
+#ifndef GL_SGIX_async_histogram
+#define GL_ASYNC_HISTOGRAM_SGIX 0x832C
+#define GL_MAX_ASYNC_HISTOGRAM_SGIX 0x832D
+#endif
+
+#ifndef GL_INTEL_texture_scissor
+#endif
+
+#ifndef GL_INTEL_parallel_arrays
+#define GL_PARALLEL_ARRAYS_INTEL 0x83F4
+#define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5
+#define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6
+#define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7
+#define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8
+#endif
+
+#ifndef GL_HP_occlusion_test
+#define GL_OCCLUSION_TEST_HP 0x8165
+#define GL_OCCLUSION_TEST_RESULT_HP 0x8166
+#endif
+
+#ifndef GL_EXT_pixel_transform
+#define GL_PIXEL_TRANSFORM_2D_EXT 0x8330
+#define GL_PIXEL_MAG_FILTER_EXT 0x8331
+#define GL_PIXEL_MIN_FILTER_EXT 0x8332
+#define GL_PIXEL_CUBIC_WEIGHT_EXT 0x8333
+#define GL_CUBIC_EXT 0x8334
+#define GL_AVERAGE_EXT 0x8335
+#define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336
+#define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337
+#define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT 0x8338
+#endif
+
+#ifndef GL_EXT_pixel_transform_color_table
+#endif
+
+#ifndef GL_EXT_shared_texture_palette
+#define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB
+#endif
+
+#ifndef GL_EXT_separate_specular_color
+#define GL_LIGHT_MODEL_COLOR_CONTROL_EXT 0x81F8
+#define GL_SINGLE_COLOR_EXT 0x81F9
+#define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA
+#endif
+
+#ifndef GL_EXT_secondary_color
+#define GL_COLOR_SUM_EXT 0x8458
+#define GL_CURRENT_SECONDARY_COLOR_EXT 0x8459
+#define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A
+#define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B
+#define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C
+#define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D
+#define GL_SECONDARY_COLOR_ARRAY_EXT 0x845E
+#endif
+
+#ifndef GL_EXT_texture_perturb_normal
+#define GL_PERTURB_EXT 0x85AE
+#define GL_TEXTURE_NORMAL_EXT 0x85AF
+#endif
+
+#ifndef GL_EXT_multi_draw_arrays
+#endif
+
+#ifndef GL_EXT_fog_coord
+#define GL_FOG_COORDINATE_SOURCE_EXT 0x8450
+#define GL_FOG_COORDINATE_EXT 0x8451
+#define GL_FRAGMENT_DEPTH_EXT 0x8452
+#define GL_CURRENT_FOG_COORDINATE_EXT 0x8453
+#define GL_FOG_COORDINATE_ARRAY_TYPE_EXT 0x8454
+#define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455
+#define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456
+#define GL_FOG_COORDINATE_ARRAY_EXT 0x8457
+#endif
+
+#ifndef GL_REND_screen_coordinates
+#define GL_SCREEN_COORDINATES_REND 0x8490
+#define GL_INVERTED_SCREEN_W_REND 0x8491
+#endif
+
+#ifndef GL_EXT_coordinate_frame
+#define GL_TANGENT_ARRAY_EXT 0x8439
+#define GL_BINORMAL_ARRAY_EXT 0x843A
+#define GL_CURRENT_TANGENT_EXT 0x843B
+#define GL_CURRENT_BINORMAL_EXT 0x843C
+#define GL_TANGENT_ARRAY_TYPE_EXT 0x843E
+#define GL_TANGENT_ARRAY_STRIDE_EXT 0x843F
+#define GL_BINORMAL_ARRAY_TYPE_EXT 0x8440
+#define GL_BINORMAL_ARRAY_STRIDE_EXT 0x8441
+#define GL_TANGENT_ARRAY_POINTER_EXT 0x8442
+#define GL_BINORMAL_ARRAY_POINTER_EXT 0x8443
+#define GL_MAP1_TANGENT_EXT 0x8444
+#define GL_MAP2_TANGENT_EXT 0x8445
+#define GL_MAP1_BINORMAL_EXT 0x8446
+#define GL_MAP2_BINORMAL_EXT 0x8447
+#endif
+
+#ifndef GL_EXT_texture_env_combine
+#define GL_COMBINE_EXT 0x8570
+#define GL_COMBINE_RGB_EXT 0x8571
+#define GL_COMBINE_ALPHA_EXT 0x8572
+#define GL_RGB_SCALE_EXT 0x8573
+#define GL_ADD_SIGNED_EXT 0x8574
+#define GL_INTERPOLATE_EXT 0x8575
+#define GL_CONSTANT_EXT 0x8576
+#define GL_PRIMARY_COLOR_EXT 0x8577
+#define GL_PREVIOUS_EXT 0x8578
+#define GL_SOURCE0_RGB_EXT 0x8580
+#define GL_SOURCE1_RGB_EXT 0x8581
+#define GL_SOURCE2_RGB_EXT 0x8582
+#define GL_SOURCE0_ALPHA_EXT 0x8588
+#define GL_SOURCE1_ALPHA_EXT 0x8589
+#define GL_SOURCE2_ALPHA_EXT 0x858A
+#define GL_OPERAND0_RGB_EXT 0x8590
+#define GL_OPERAND1_RGB_EXT 0x8591
+#define GL_OPERAND2_RGB_EXT 0x8592
+#define GL_OPERAND0_ALPHA_EXT 0x8598
+#define GL_OPERAND1_ALPHA_EXT 0x8599
+#define GL_OPERAND2_ALPHA_EXT 0x859A
+#endif
+
+#ifndef GL_APPLE_specular_vector
+#define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0
+#endif
+
+#ifndef GL_APPLE_transform_hint
+#define GL_TRANSFORM_HINT_APPLE 0x85B1
+#endif
+
+#ifndef GL_SGIX_fog_scale
+#define GL_FOG_SCALE_SGIX 0x81FC
+#define GL_FOG_SCALE_VALUE_SGIX 0x81FD
+#endif
+
+#ifndef GL_SUNX_constant_data
+#define GL_UNPACK_CONSTANT_DATA_SUNX 0x81D5
+#define GL_TEXTURE_CONSTANT_DATA_SUNX 0x81D6
+#endif
+
+#ifndef GL_SUN_global_alpha
+#define GL_GLOBAL_ALPHA_SUN 0x81D9
+#define GL_GLOBAL_ALPHA_FACTOR_SUN 0x81DA
+#endif
+
+#ifndef GL_SUN_triangle_list
+#define GL_RESTART_SUN 0x0001
+#define GL_REPLACE_MIDDLE_SUN 0x0002
+#define GL_REPLACE_OLDEST_SUN 0x0003
+#define GL_TRIANGLE_LIST_SUN 0x81D7
+#define GL_REPLACEMENT_CODE_SUN 0x81D8
+#define GL_REPLACEMENT_CODE_ARRAY_SUN 0x85C0
+#define GL_REPLACEMENT_CODE_ARRAY_TYPE_SUN 0x85C1
+#define GL_REPLACEMENT_CODE_ARRAY_STRIDE_SUN 0x85C2
+#define GL_REPLACEMENT_CODE_ARRAY_POINTER_SUN 0x85C3
+#define GL_R1UI_V3F_SUN 0x85C4
+#define GL_R1UI_C4UB_V3F_SUN 0x85C5
+#define GL_R1UI_C3F_V3F_SUN 0x85C6
+#define GL_R1UI_N3F_V3F_SUN 0x85C7
+#define GL_R1UI_C4F_N3F_V3F_SUN 0x85C8
+#define GL_R1UI_T2F_V3F_SUN 0x85C9
+#define GL_R1UI_T2F_N3F_V3F_SUN 0x85CA
+#define GL_R1UI_T2F_C4F_N3F_V3F_SUN 0x85CB
+#endif
+
+#ifndef GL_SUN_vertex
+#endif
+
+#ifndef GL_EXT_blend_func_separate
+#define GL_BLEND_DST_RGB_EXT 0x80C8
+#define GL_BLEND_SRC_RGB_EXT 0x80C9
+#define GL_BLEND_DST_ALPHA_EXT 0x80CA
+#define GL_BLEND_SRC_ALPHA_EXT 0x80CB
+#endif
+
+#ifndef GL_INGR_color_clamp
+#define GL_RED_MIN_CLAMP_INGR 0x8560
+#define GL_GREEN_MIN_CLAMP_INGR 0x8561
+#define GL_BLUE_MIN_CLAMP_INGR 0x8562
+#define GL_ALPHA_MIN_CLAMP_INGR 0x8563
+#define GL_RED_MAX_CLAMP_INGR 0x8564
+#define GL_GREEN_MAX_CLAMP_INGR 0x8565
+#define GL_BLUE_MAX_CLAMP_INGR 0x8566
+#define GL_ALPHA_MAX_CLAMP_INGR 0x8567
+#endif
+
+#ifndef GL_INGR_interlace_read
+#define GL_INTERLACE_READ_INGR 0x8568
+#endif
+
+#ifndef GL_EXT_stencil_wrap
+#define GL_INCR_WRAP_EXT 0x8507
+#define GL_DECR_WRAP_EXT 0x8508
+#endif
+
+#ifndef GL_EXT_422_pixels
+#define GL_422_EXT 0x80CC
+#define GL_422_REV_EXT 0x80CD
+#define GL_422_AVERAGE_EXT 0x80CE
+#define GL_422_REV_AVERAGE_EXT 0x80CF
+#endif
+
+#ifndef GL_NV_texgen_reflection
+#define GL_NORMAL_MAP_NV 0x8511
+#define GL_REFLECTION_MAP_NV 0x8512
+#endif
+
+#ifndef GL_EXT_texture_cube_map
+#define GL_NORMAL_MAP_EXT 0x8511
+#define GL_REFLECTION_MAP_EXT 0x8512
+#define GL_TEXTURE_CUBE_MAP_EXT 0x8513
+#define GL_TEXTURE_BINDING_CUBE_MAP_EXT 0x8514
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A
+#define GL_PROXY_TEXTURE_CUBE_MAP_EXT 0x851B
+#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT 0x851C
+#endif
+
+#ifndef GL_SUN_convolution_border_modes
+#define GL_WRAP_BORDER_SUN 0x81D4
+#endif
+
+#ifndef GL_EXT_texture_env_add
+#endif
+
+#ifndef GL_EXT_texture_lod_bias
+#define GL_MAX_TEXTURE_LOD_BIAS_EXT 0x84FD
+#define GL_TEXTURE_FILTER_CONTROL_EXT 0x8500
+#define GL_TEXTURE_LOD_BIAS_EXT 0x8501
+#endif
+
+#ifndef GL_EXT_texture_filter_anisotropic
+#define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE
+#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF
+#endif
+
+#ifndef GL_EXT_vertex_weighting
+#define GL_MODELVIEW0_STACK_DEPTH_EXT GL_MODELVIEW_STACK_DEPTH
+#define GL_MODELVIEW1_STACK_DEPTH_EXT 0x8502
+#define GL_MODELVIEW0_MATRIX_EXT GL_MODELVIEW_MATRIX
+#define GL_MODELVIEW1_MATRIX_EXT 0x8506
+#define GL_VERTEX_WEIGHTING_EXT 0x8509
+#define GL_MODELVIEW0_EXT GL_MODELVIEW
+#define GL_MODELVIEW1_EXT 0x850A
+#define GL_CURRENT_VERTEX_WEIGHT_EXT 0x850B
+#define GL_VERTEX_WEIGHT_ARRAY_EXT 0x850C
+#define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT 0x850D
+#define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT 0x850E
+#define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F
+#define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510
+#endif
+
+#ifndef GL_NV_light_max_exponent
+#define GL_MAX_SHININESS_NV 0x8504
+#define GL_MAX_SPOT_EXPONENT_NV 0x8505
+#endif
+
+#ifndef GL_NV_vertex_array_range
+#define GL_VERTEX_ARRAY_RANGE_NV 0x851D
+#define GL_VERTEX_ARRAY_RANGE_LENGTH_NV 0x851E
+#define GL_VERTEX_ARRAY_RANGE_VALID_NV 0x851F
+#define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520
+#define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521
+#endif
+
+#ifndef GL_NV_register_combiners
+#define GL_REGISTER_COMBINERS_NV 0x8522
+#define GL_VARIABLE_A_NV 0x8523
+#define GL_VARIABLE_B_NV 0x8524
+#define GL_VARIABLE_C_NV 0x8525
+#define GL_VARIABLE_D_NV 0x8526
+#define GL_VARIABLE_E_NV 0x8527
+#define GL_VARIABLE_F_NV 0x8528
+#define GL_VARIABLE_G_NV 0x8529
+#define GL_CONSTANT_COLOR0_NV 0x852A
+#define GL_CONSTANT_COLOR1_NV 0x852B
+#define GL_PRIMARY_COLOR_NV 0x852C
+#define GL_SECONDARY_COLOR_NV 0x852D
+#define GL_SPARE0_NV 0x852E
+#define GL_SPARE1_NV 0x852F
+#define GL_DISCARD_NV 0x8530
+#define GL_E_TIMES_F_NV 0x8531
+#define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532
+#define GL_UNSIGNED_IDENTITY_NV 0x8536
+#define GL_UNSIGNED_INVERT_NV 0x8537
+#define GL_EXPAND_NORMAL_NV 0x8538
+#define GL_EXPAND_NEGATE_NV 0x8539
+#define GL_HALF_BIAS_NORMAL_NV 0x853A
+#define GL_HALF_BIAS_NEGATE_NV 0x853B
+#define GL_SIGNED_IDENTITY_NV 0x853C
+#define GL_SIGNED_NEGATE_NV 0x853D
+#define GL_SCALE_BY_TWO_NV 0x853E
+#define GL_SCALE_BY_FOUR_NV 0x853F
+#define GL_SCALE_BY_ONE_HALF_NV 0x8540
+#define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV 0x8541
+#define GL_COMBINER_INPUT_NV 0x8542
+#define GL_COMBINER_MAPPING_NV 0x8543
+#define GL_COMBINER_COMPONENT_USAGE_NV 0x8544
+#define GL_COMBINER_AB_DOT_PRODUCT_NV 0x8545
+#define GL_COMBINER_CD_DOT_PRODUCT_NV 0x8546
+#define GL_COMBINER_MUX_SUM_NV 0x8547
+#define GL_COMBINER_SCALE_NV 0x8548
+#define GL_COMBINER_BIAS_NV 0x8549
+#define GL_COMBINER_AB_OUTPUT_NV 0x854A
+#define GL_COMBINER_CD_OUTPUT_NV 0x854B
+#define GL_COMBINER_SUM_OUTPUT_NV 0x854C
+#define GL_MAX_GENERAL_COMBINERS_NV 0x854D
+#define GL_NUM_GENERAL_COMBINERS_NV 0x854E
+#define GL_COLOR_SUM_CLAMP_NV 0x854F
+#define GL_COMBINER0_NV 0x8550
+#define GL_COMBINER1_NV 0x8551
+#define GL_COMBINER2_NV 0x8552
+#define GL_COMBINER3_NV 0x8553
+#define GL_COMBINER4_NV 0x8554
+#define GL_COMBINER5_NV 0x8555
+#define GL_COMBINER6_NV 0x8556
+#define GL_COMBINER7_NV 0x8557
+/* reuse GL_TEXTURE0_ARB */
+/* reuse GL_TEXTURE1_ARB */
+/* reuse GL_ZERO */
+/* reuse GL_NONE */
+/* reuse GL_FOG */
+#endif
+
+#ifndef GL_NV_fog_distance
+#define GL_FOG_DISTANCE_MODE_NV 0x855A
+#define GL_EYE_RADIAL_NV 0x855B
+#define GL_EYE_PLANE_ABSOLUTE_NV 0x855C
+/* reuse GL_EYE_PLANE */
+#endif
+
+#ifndef GL_NV_texgen_emboss
+#define GL_EMBOSS_LIGHT_NV 0x855D
+#define GL_EMBOSS_CONSTANT_NV 0x855E
+#define GL_EMBOSS_MAP_NV 0x855F
+#endif
+
+#ifndef GL_NV_blend_square
+#endif
+
+#ifndef GL_NV_texture_env_combine4
+#define GL_COMBINE4_NV 0x8503
+#define GL_SOURCE3_RGB_NV 0x8583
+#define GL_SOURCE3_ALPHA_NV 0x858B
+#define GL_OPERAND3_RGB_NV 0x8593
+#define GL_OPERAND3_ALPHA_NV 0x859B
+#endif
+
+#ifndef GL_MESA_resize_buffers
+#endif
+
+#ifndef GL_MESA_window_pos
+#endif
+
+#ifndef GL_EXT_texture_compression_s3tc
+#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0
+#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1
+#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2
+#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3
+#endif
+
+#ifndef GL_IBM_cull_vertex
+#define GL_CULL_VERTEX_IBM 103050
+#endif
+
+#ifndef GL_IBM_multimode_draw_arrays
+#endif
+
+#ifndef GL_IBM_vertex_array_lists
+#define GL_VERTEX_ARRAY_LIST_IBM 103070
+#define GL_NORMAL_ARRAY_LIST_IBM 103071
+#define GL_COLOR_ARRAY_LIST_IBM 103072
+#define GL_INDEX_ARRAY_LIST_IBM 103073
+#define GL_TEXTURE_COORD_ARRAY_LIST_IBM 103074
+#define GL_EDGE_FLAG_ARRAY_LIST_IBM 103075
+#define GL_FOG_COORDINATE_ARRAY_LIST_IBM 103076
+#define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077
+#define GL_VERTEX_ARRAY_LIST_STRIDE_IBM 103080
+#define GL_NORMAL_ARRAY_LIST_STRIDE_IBM 103081
+#define GL_COLOR_ARRAY_LIST_STRIDE_IBM 103082
+#define GL_INDEX_ARRAY_LIST_STRIDE_IBM 103083
+#define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084
+#define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085
+#define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086
+#define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087
+#endif
+
+#ifndef GL_SGIX_subsample
+#define GL_PACK_SUBSAMPLE_RATE_SGIX 0x85A0
+#define GL_UNPACK_SUBSAMPLE_RATE_SGIX 0x85A1
+#define GL_PIXEL_SUBSAMPLE_4444_SGIX 0x85A2
+#define GL_PIXEL_SUBSAMPLE_2424_SGIX 0x85A3
+#define GL_PIXEL_SUBSAMPLE_4242_SGIX 0x85A4
+#endif
+
+#ifndef GL_SGIX_ycrcb_subsample
+#endif
+
+#ifndef GL_SGIX_ycrcba
+#define GL_YCRCB_SGIX 0x8318
+#define GL_YCRCBA_SGIX 0x8319
+#endif
+
+#ifndef GL_SGI_depth_pass_instrument
+#define GL_DEPTH_PASS_INSTRUMENT_SGIX 0x8310
+#define GL_DEPTH_PASS_INSTRUMENT_COUNTERS_SGIX 0x8311
+#define GL_DEPTH_PASS_INSTRUMENT_MAX_SGIX 0x8312
+#endif
+
+#ifndef GL_3DFX_texture_compression_FXT1
+#define GL_COMPRESSED_RGB_FXT1_3DFX 0x86B0
+#define GL_COMPRESSED_RGBA_FXT1_3DFX 0x86B1
+#endif
+
+#ifndef GL_3DFX_multisample
+#define GL_MULTISAMPLE_3DFX 0x86B2
+#define GL_SAMPLE_BUFFERS_3DFX 0x86B3
+#define GL_SAMPLES_3DFX 0x86B4
+#define GL_MULTISAMPLE_BIT_3DFX 0x20000000
+#endif
+
+#ifndef GL_3DFX_tbuffer
+#endif
+
+#ifndef GL_EXT_multisample
+#define GL_MULTISAMPLE_EXT 0x809D
+#define GL_SAMPLE_ALPHA_TO_MASK_EXT 0x809E
+#define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F
+#define GL_SAMPLE_MASK_EXT 0x80A0
+#define GL_1PASS_EXT 0x80A1
+#define GL_2PASS_0_EXT 0x80A2
+#define GL_2PASS_1_EXT 0x80A3
+#define GL_4PASS_0_EXT 0x80A4
+#define GL_4PASS_1_EXT 0x80A5
+#define GL_4PASS_2_EXT 0x80A6
+#define GL_4PASS_3_EXT 0x80A7
+#define GL_SAMPLE_BUFFERS_EXT 0x80A8
+#define GL_SAMPLES_EXT 0x80A9
+#define GL_SAMPLE_MASK_VALUE_EXT 0x80AA
+#define GL_SAMPLE_MASK_INVERT_EXT 0x80AB
+#define GL_SAMPLE_PATTERN_EXT 0x80AC
+#define GL_MULTISAMPLE_BIT_EXT 0x20000000
+#endif
+
+#ifndef GL_SGIX_vertex_preclip
+#define GL_VERTEX_PRECLIP_SGIX 0x83EE
+#define GL_VERTEX_PRECLIP_HINT_SGIX 0x83EF
+#endif
+
+#ifndef GL_SGIX_convolution_accuracy
+#define GL_CONVOLUTION_HINT_SGIX 0x8316
+#endif
+
+#ifndef GL_SGIX_resample
+#define GL_PACK_RESAMPLE_SGIX 0x842C
+#define GL_UNPACK_RESAMPLE_SGIX 0x842D
+#define GL_RESAMPLE_REPLICATE_SGIX 0x842E
+#define GL_RESAMPLE_ZERO_FILL_SGIX 0x842F
+#define GL_RESAMPLE_DECIMATE_SGIX 0x8430
+#endif
+
+#ifndef GL_SGIS_point_line_texgen
+#define GL_EYE_DISTANCE_TO_POINT_SGIS 0x81F0
+#define GL_OBJECT_DISTANCE_TO_POINT_SGIS 0x81F1
+#define GL_EYE_DISTANCE_TO_LINE_SGIS 0x81F2
+#define GL_OBJECT_DISTANCE_TO_LINE_SGIS 0x81F3
+#define GL_EYE_POINT_SGIS 0x81F4
+#define GL_OBJECT_POINT_SGIS 0x81F5
+#define GL_EYE_LINE_SGIS 0x81F6
+#define GL_OBJECT_LINE_SGIS 0x81F7
+#endif
+
+#ifndef GL_SGIS_texture_color_mask
+#define GL_TEXTURE_COLOR_WRITEMASK_SGIS 0x81EF
+#endif
+
+#ifndef GL_EXT_texture_env_dot3
+#define GL_DOT3_RGB_EXT 0x8740
+#define GL_DOT3_RGBA_EXT 0x8741
+#endif
+
+#ifndef GL_ATI_texture_mirror_once
+#define GL_MIRROR_CLAMP_ATI 0x8742
+#define GL_MIRROR_CLAMP_TO_EDGE_ATI 0x8743
+#endif
+
+#ifndef GL_NV_fence
+#define GL_ALL_COMPLETED_NV 0x84F2
+#define GL_FENCE_STATUS_NV 0x84F3
+#define GL_FENCE_CONDITION_NV 0x84F4
+#endif
+
+#ifndef GL_IBM_texture_mirrored_repeat
+#define GL_MIRRORED_REPEAT_IBM 0x8370
+#endif
+
+#ifndef GL_NV_evaluators
+#define GL_EVAL_2D_NV 0x86C0
+#define GL_EVAL_TRIANGULAR_2D_NV 0x86C1
+#define GL_MAP_TESSELLATION_NV 0x86C2
+#define GL_MAP_ATTRIB_U_ORDER_NV 0x86C3
+#define GL_MAP_ATTRIB_V_ORDER_NV 0x86C4
+#define GL_EVAL_FRACTIONAL_TESSELLATION_NV 0x86C5
+#define GL_EVAL_VERTEX_ATTRIB0_NV 0x86C6
+#define GL_EVAL_VERTEX_ATTRIB1_NV 0x86C7
+#define GL_EVAL_VERTEX_ATTRIB2_NV 0x86C8
+#define GL_EVAL_VERTEX_ATTRIB3_NV 0x86C9
+#define GL_EVAL_VERTEX_ATTRIB4_NV 0x86CA
+#define GL_EVAL_VERTEX_ATTRIB5_NV 0x86CB
+#define GL_EVAL_VERTEX_ATTRIB6_NV 0x86CC
+#define GL_EVAL_VERTEX_ATTRIB7_NV 0x86CD
+#define GL_EVAL_VERTEX_ATTRIB8_NV 0x86CE
+#define GL_EVAL_VERTEX_ATTRIB9_NV 0x86CF
+#define GL_EVAL_VERTEX_ATTRIB10_NV 0x86D0
+#define GL_EVAL_VERTEX_ATTRIB11_NV 0x86D1
+#define GL_EVAL_VERTEX_ATTRIB12_NV 0x86D2
+#define GL_EVAL_VERTEX_ATTRIB13_NV 0x86D3
+#define GL_EVAL_VERTEX_ATTRIB14_NV 0x86D4
+#define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5
+#define GL_MAX_MAP_TESSELLATION_NV 0x86D6
+#define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7
+#endif
+
+#ifndef GL_NV_packed_depth_stencil
+#define GL_DEPTH_STENCIL_NV 0x84F9
+#define GL_UNSIGNED_INT_24_8_NV 0x84FA
+#endif
+
+#ifndef GL_NV_register_combiners2
+#define GL_PER_STAGE_CONSTANTS_NV 0x8535
+#endif
+
+#ifndef GL_NV_texture_compression_vtc
+#endif
+
+#ifndef GL_NV_texture_rectangle
+#define GL_TEXTURE_RECTANGLE_NV 0x84F5
+#define GL_TEXTURE_BINDING_RECTANGLE_NV 0x84F6
+#define GL_PROXY_TEXTURE_RECTANGLE_NV 0x84F7
+#define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8
+#endif
+
+#ifndef GL_NV_texture_shader
+#define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C
+#define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D
+#define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E
+#define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9
+#define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA
+#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB
+#define GL_DSDT_MAG_INTENSITY_NV 0x86DC
+#define GL_SHADER_CONSISTENT_NV 0x86DD
+#define GL_TEXTURE_SHADER_NV 0x86DE
+#define GL_SHADER_OPERATION_NV 0x86DF
+#define GL_CULL_MODES_NV 0x86E0
+#define GL_OFFSET_TEXTURE_MATRIX_NV 0x86E1
+#define GL_OFFSET_TEXTURE_SCALE_NV 0x86E2
+#define GL_OFFSET_TEXTURE_BIAS_NV 0x86E3
+#define GL_OFFSET_TEXTURE_2D_MATRIX_NV GL_OFFSET_TEXTURE_MATRIX_NV
+#define GL_OFFSET_TEXTURE_2D_SCALE_NV GL_OFFSET_TEXTURE_SCALE_NV
+#define GL_OFFSET_TEXTURE_2D_BIAS_NV GL_OFFSET_TEXTURE_BIAS_NV
+#define GL_PREVIOUS_TEXTURE_INPUT_NV 0x86E4
+#define GL_CONST_EYE_NV 0x86E5
+#define GL_PASS_THROUGH_NV 0x86E6
+#define GL_CULL_FRAGMENT_NV 0x86E7
+#define GL_OFFSET_TEXTURE_2D_NV 0x86E8
+#define GL_DEPENDENT_AR_TEXTURE_2D_NV 0x86E9
+#define GL_DEPENDENT_GB_TEXTURE_2D_NV 0x86EA
+#define GL_DOT_PRODUCT_NV 0x86EC
+#define GL_DOT_PRODUCT_DEPTH_REPLACE_NV 0x86ED
+#define GL_DOT_PRODUCT_TEXTURE_2D_NV 0x86EE
+#define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0
+#define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1
+#define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2
+#define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3
+#define GL_HILO_NV 0x86F4
+#define GL_DSDT_NV 0x86F5
+#define GL_DSDT_MAG_NV 0x86F6
+#define GL_DSDT_MAG_VIB_NV 0x86F7
+#define GL_HILO16_NV 0x86F8
+#define GL_SIGNED_HILO_NV 0x86F9
+#define GL_SIGNED_HILO16_NV 0x86FA
+#define GL_SIGNED_RGBA_NV 0x86FB
+#define GL_SIGNED_RGBA8_NV 0x86FC
+#define GL_SIGNED_RGB_NV 0x86FE
+#define GL_SIGNED_RGB8_NV 0x86FF
+#define GL_SIGNED_LUMINANCE_NV 0x8701
+#define GL_SIGNED_LUMINANCE8_NV 0x8702
+#define GL_SIGNED_LUMINANCE_ALPHA_NV 0x8703
+#define GL_SIGNED_LUMINANCE8_ALPHA8_NV 0x8704
+#define GL_SIGNED_ALPHA_NV 0x8705
+#define GL_SIGNED_ALPHA8_NV 0x8706
+#define GL_SIGNED_INTENSITY_NV 0x8707
+#define GL_SIGNED_INTENSITY8_NV 0x8708
+#define GL_DSDT8_NV 0x8709
+#define GL_DSDT8_MAG8_NV 0x870A
+#define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B
+#define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV 0x870C
+#define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D
+#define GL_HI_SCALE_NV 0x870E
+#define GL_LO_SCALE_NV 0x870F
+#define GL_DS_SCALE_NV 0x8710
+#define GL_DT_SCALE_NV 0x8711
+#define GL_MAGNITUDE_SCALE_NV 0x8712
+#define GL_VIBRANCE_SCALE_NV 0x8713
+#define GL_HI_BIAS_NV 0x8714
+#define GL_LO_BIAS_NV 0x8715
+#define GL_DS_BIAS_NV 0x8716
+#define GL_DT_BIAS_NV 0x8717
+#define GL_MAGNITUDE_BIAS_NV 0x8718
+#define GL_VIBRANCE_BIAS_NV 0x8719
+#define GL_TEXTURE_BORDER_VALUES_NV 0x871A
+#define GL_TEXTURE_HI_SIZE_NV 0x871B
+#define GL_TEXTURE_LO_SIZE_NV 0x871C
+#define GL_TEXTURE_DS_SIZE_NV 0x871D
+#define GL_TEXTURE_DT_SIZE_NV 0x871E
+#define GL_TEXTURE_MAG_SIZE_NV 0x871F
+#endif
+
+#ifndef GL_NV_texture_shader2
+#define GL_DOT_PRODUCT_TEXTURE_3D_NV 0x86EF
+#endif
+
+#ifndef GL_NV_vertex_array_range2
+#define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533
+#endif
+
+#ifndef GL_NV_vertex_program
+#define GL_VERTEX_PROGRAM_NV 0x8620
+#define GL_VERTEX_STATE_PROGRAM_NV 0x8621
+#define GL_ATTRIB_ARRAY_SIZE_NV 0x8623
+#define GL_ATTRIB_ARRAY_STRIDE_NV 0x8624
+#define GL_ATTRIB_ARRAY_TYPE_NV 0x8625
+#define GL_CURRENT_ATTRIB_NV 0x8626
+#define GL_PROGRAM_LENGTH_NV 0x8627
+#define GL_PROGRAM_STRING_NV 0x8628
+#define GL_MODELVIEW_PROJECTION_NV 0x8629
+#define GL_IDENTITY_NV 0x862A
+#define GL_INVERSE_NV 0x862B
+#define GL_TRANSPOSE_NV 0x862C
+#define GL_INVERSE_TRANSPOSE_NV 0x862D
+#define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E
+#define GL_MAX_TRACK_MATRICES_NV 0x862F
+#define GL_MATRIX0_NV 0x8630
+#define GL_MATRIX1_NV 0x8631
+#define GL_MATRIX2_NV 0x8632
+#define GL_MATRIX3_NV 0x8633
+#define GL_MATRIX4_NV 0x8634
+#define GL_MATRIX5_NV 0x8635
+#define GL_MATRIX6_NV 0x8636
+#define GL_MATRIX7_NV 0x8637
+#define GL_CURRENT_MATRIX_STACK_DEPTH_NV 0x8640
+#define GL_CURRENT_MATRIX_NV 0x8641
+#define GL_VERTEX_PROGRAM_POINT_SIZE_NV 0x8642
+#define GL_VERTEX_PROGRAM_TWO_SIDE_NV 0x8643
+#define GL_PROGRAM_PARAMETER_NV 0x8644
+#define GL_ATTRIB_ARRAY_POINTER_NV 0x8645
+#define GL_PROGRAM_TARGET_NV 0x8646
+#define GL_PROGRAM_RESIDENT_NV 0x8647
+#define GL_TRACK_MATRIX_NV 0x8648
+#define GL_TRACK_MATRIX_TRANSFORM_NV 0x8649
+#define GL_VERTEX_PROGRAM_BINDING_NV 0x864A
+#define GL_PROGRAM_ERROR_POSITION_NV 0x864B
+#define GL_VERTEX_ATTRIB_ARRAY0_NV 0x8650
+#define GL_VERTEX_ATTRIB_ARRAY1_NV 0x8651
+#define GL_VERTEX_ATTRIB_ARRAY2_NV 0x8652
+#define GL_VERTEX_ATTRIB_ARRAY3_NV 0x8653
+#define GL_VERTEX_ATTRIB_ARRAY4_NV 0x8654
+#define GL_VERTEX_ATTRIB_ARRAY5_NV 0x8655
+#define GL_VERTEX_ATTRIB_ARRAY6_NV 0x8656
+#define GL_VERTEX_ATTRIB_ARRAY7_NV 0x8657
+#define GL_VERTEX_ATTRIB_ARRAY8_NV 0x8658
+#define GL_VERTEX_ATTRIB_ARRAY9_NV 0x8659
+#define GL_VERTEX_ATTRIB_ARRAY10_NV 0x865A
+#define GL_VERTEX_ATTRIB_ARRAY11_NV 0x865B
+#define GL_VERTEX_ATTRIB_ARRAY12_NV 0x865C
+#define GL_VERTEX_ATTRIB_ARRAY13_NV 0x865D
+#define GL_VERTEX_ATTRIB_ARRAY14_NV 0x865E
+#define GL_VERTEX_ATTRIB_ARRAY15_NV 0x865F
+#define GL_MAP1_VERTEX_ATTRIB0_4_NV 0x8660
+#define GL_MAP1_VERTEX_ATTRIB1_4_NV 0x8661
+#define GL_MAP1_VERTEX_ATTRIB2_4_NV 0x8662
+#define GL_MAP1_VERTEX_ATTRIB3_4_NV 0x8663
+#define GL_MAP1_VERTEX_ATTRIB4_4_NV 0x8664
+#define GL_MAP1_VERTEX_ATTRIB5_4_NV 0x8665
+#define GL_MAP1_VERTEX_ATTRIB6_4_NV 0x8666
+#define GL_MAP1_VERTEX_ATTRIB7_4_NV 0x8667
+#define GL_MAP1_VERTEX_ATTRIB8_4_NV 0x8668
+#define GL_MAP1_VERTEX_ATTRIB9_4_NV 0x8669
+#define GL_MAP1_VERTEX_ATTRIB10_4_NV 0x866A
+#define GL_MAP1_VERTEX_ATTRIB11_4_NV 0x866B
+#define GL_MAP1_VERTEX_ATTRIB12_4_NV 0x866C
+#define GL_MAP1_VERTEX_ATTRIB13_4_NV 0x866D
+#define GL_MAP1_VERTEX_ATTRIB14_4_NV 0x866E
+#define GL_MAP1_VERTEX_ATTRIB15_4_NV 0x866F
+#define GL_MAP2_VERTEX_ATTRIB0_4_NV 0x8670
+#define GL_MAP2_VERTEX_ATTRIB1_4_NV 0x8671
+#define GL_MAP2_VERTEX_ATTRIB2_4_NV 0x8672
+#define GL_MAP2_VERTEX_ATTRIB3_4_NV 0x8673
+#define GL_MAP2_VERTEX_ATTRIB4_4_NV 0x8674
+#define GL_MAP2_VERTEX_ATTRIB5_4_NV 0x8675
+#define GL_MAP2_VERTEX_ATTRIB6_4_NV 0x8676
+#define GL_MAP2_VERTEX_ATTRIB7_4_NV 0x8677
+#define GL_MAP2_VERTEX_ATTRIB8_4_NV 0x8678
+#define GL_MAP2_VERTEX_ATTRIB9_4_NV 0x8679
+#define GL_MAP2_VERTEX_ATTRIB10_4_NV 0x867A
+#define GL_MAP2_VERTEX_ATTRIB11_4_NV 0x867B
+#define GL_MAP2_VERTEX_ATTRIB12_4_NV 0x867C
+#define GL_MAP2_VERTEX_ATTRIB13_4_NV 0x867D
+#define GL_MAP2_VERTEX_ATTRIB14_4_NV 0x867E
+#define GL_MAP2_VERTEX_ATTRIB15_4_NV 0x867F
+#endif
+
+#ifndef GL_SGIX_texture_coordinate_clamp
+#define GL_TEXTURE_MAX_CLAMP_S_SGIX 0x8369
+#define GL_TEXTURE_MAX_CLAMP_T_SGIX 0x836A
+#define GL_TEXTURE_MAX_CLAMP_R_SGIX 0x836B
+#endif
+
+#ifndef GL_SGIX_scalebias_hint
+#define GL_SCALEBIAS_HINT_SGIX 0x8322
+#endif
+
+#ifndef GL_OML_interlace
+#define GL_INTERLACE_OML 0x8980
+#define GL_INTERLACE_READ_OML 0x8981
+#endif
+
+#ifndef GL_OML_subsample
+#define GL_FORMAT_SUBSAMPLE_24_24_OML 0x8982
+#define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983
+#endif
+
+#ifndef GL_OML_resample
+#define GL_PACK_RESAMPLE_OML 0x8984
+#define GL_UNPACK_RESAMPLE_OML 0x8985
+#define GL_RESAMPLE_REPLICATE_OML 0x8986
+#define GL_RESAMPLE_ZERO_FILL_OML 0x8987
+#define GL_RESAMPLE_AVERAGE_OML 0x8988
+#define GL_RESAMPLE_DECIMATE_OML 0x8989
+#endif
+
+#ifndef GL_NV_copy_depth_to_color
+#define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E
+#define GL_DEPTH_STENCIL_TO_BGRA_NV 0x886F
+#endif
+
+#ifndef GL_ATI_envmap_bumpmap
+#define GL_BUMP_ROT_MATRIX_ATI 0x8775
+#define GL_BUMP_ROT_MATRIX_SIZE_ATI 0x8776
+#define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777
+#define GL_BUMP_TEX_UNITS_ATI 0x8778
+#define GL_DUDV_ATI 0x8779
+#define GL_DU8DV8_ATI 0x877A
+#define GL_BUMP_ENVMAP_ATI 0x877B
+#define GL_BUMP_TARGET_ATI 0x877C
+#endif
+
+#ifndef GL_ATI_fragment_shader
+#define GL_FRAGMENT_SHADER_ATI 0x8920
+#define GL_REG_0_ATI 0x8921
+#define GL_REG_1_ATI 0x8922
+#define GL_REG_2_ATI 0x8923
+#define GL_REG_3_ATI 0x8924
+#define GL_REG_4_ATI 0x8925
+#define GL_REG_5_ATI 0x8926
+#define GL_REG_6_ATI 0x8927
+#define GL_REG_7_ATI 0x8928
+#define GL_REG_8_ATI 0x8929
+#define GL_REG_9_ATI 0x892A
+#define GL_REG_10_ATI 0x892B
+#define GL_REG_11_ATI 0x892C
+#define GL_REG_12_ATI 0x892D
+#define GL_REG_13_ATI 0x892E
+#define GL_REG_14_ATI 0x892F
+#define GL_REG_15_ATI 0x8930
+#define GL_REG_16_ATI 0x8931
+#define GL_REG_17_ATI 0x8932
+#define GL_REG_18_ATI 0x8933
+#define GL_REG_19_ATI 0x8934
+#define GL_REG_20_ATI 0x8935
+#define GL_REG_21_ATI 0x8936
+#define GL_REG_22_ATI 0x8937
+#define GL_REG_23_ATI 0x8938
+#define GL_REG_24_ATI 0x8939
+#define GL_REG_25_ATI 0x893A
+#define GL_REG_26_ATI 0x893B
+#define GL_REG_27_ATI 0x893C
+#define GL_REG_28_ATI 0x893D
+#define GL_REG_29_ATI 0x893E
+#define GL_REG_30_ATI 0x893F
+#define GL_REG_31_ATI 0x8940
+#define GL_CON_0_ATI 0x8941
+#define GL_CON_1_ATI 0x8942
+#define GL_CON_2_ATI 0x8943
+#define GL_CON_3_ATI 0x8944
+#define GL_CON_4_ATI 0x8945
+#define GL_CON_5_ATI 0x8946
+#define GL_CON_6_ATI 0x8947
+#define GL_CON_7_ATI 0x8948
+#define GL_CON_8_ATI 0x8949
+#define GL_CON_9_ATI 0x894A
+#define GL_CON_10_ATI 0x894B
+#define GL_CON_11_ATI 0x894C
+#define GL_CON_12_ATI 0x894D
+#define GL_CON_13_ATI 0x894E
+#define GL_CON_14_ATI 0x894F
+#define GL_CON_15_ATI 0x8950
+#define GL_CON_16_ATI 0x8951
+#define GL_CON_17_ATI 0x8952
+#define GL_CON_18_ATI 0x8953
+#define GL_CON_19_ATI 0x8954
+#define GL_CON_20_ATI 0x8955
+#define GL_CON_21_ATI 0x8956
+#define GL_CON_22_ATI 0x8957
+#define GL_CON_23_ATI 0x8958
+#define GL_CON_24_ATI 0x8959
+#define GL_CON_25_ATI 0x895A
+#define GL_CON_26_ATI 0x895B
+#define GL_CON_27_ATI 0x895C
+#define GL_CON_28_ATI 0x895D
+#define GL_CON_29_ATI 0x895E
+#define GL_CON_30_ATI 0x895F
+#define GL_CON_31_ATI 0x8960
+#define GL_MOV_ATI 0x8961
+#define GL_ADD_ATI 0x8963
+#define GL_MUL_ATI 0x8964
+#define GL_SUB_ATI 0x8965
+#define GL_DOT3_ATI 0x8966
+#define GL_DOT4_ATI 0x8967
+#define GL_MAD_ATI 0x8968
+#define GL_LERP_ATI 0x8969
+#define GL_CND_ATI 0x896A
+#define GL_CND0_ATI 0x896B
+#define GL_DOT2_ADD_ATI 0x896C
+#define GL_SECONDARY_INTERPOLATOR_ATI 0x896D
+#define GL_NUM_FRAGMENT_REGISTERS_ATI 0x896E
+#define GL_NUM_FRAGMENT_CONSTANTS_ATI 0x896F
+#define GL_NUM_PASSES_ATI 0x8970
+#define GL_NUM_INSTRUCTIONS_PER_PASS_ATI 0x8971
+#define GL_NUM_INSTRUCTIONS_TOTAL_ATI 0x8972
+#define GL_NUM_INPUT_INTERPOLATOR_COMPONENTS_ATI 0x8973
+#define GL_NUM_LOOPBACK_COMPONENTS_ATI 0x8974
+#define GL_COLOR_ALPHA_PAIRING_ATI 0x8975
+#define GL_SWIZZLE_STR_ATI 0x8976
+#define GL_SWIZZLE_STQ_ATI 0x8977
+#define GL_SWIZZLE_STR_DR_ATI 0x8978
+#define GL_SWIZZLE_STQ_DQ_ATI 0x8979
+#define GL_SWIZZLE_STRQ_ATI 0x897A
+#define GL_SWIZZLE_STRQ_DQ_ATI 0x897B
+#define GL_RED_BIT_ATI 0x00000001
+#define GL_GREEN_BIT_ATI 0x00000002
+#define GL_BLUE_BIT_ATI 0x00000004
+#define GL_2X_BIT_ATI 0x00000001
+#define GL_4X_BIT_ATI 0x00000002
+#define GL_8X_BIT_ATI 0x00000004
+#define GL_HALF_BIT_ATI 0x00000008
+#define GL_QUARTER_BIT_ATI 0x00000010
+#define GL_EIGHTH_BIT_ATI 0x00000020
+#define GL_SATURATE_BIT_ATI 0x00000040
+#define GL_COMP_BIT_ATI 0x00000002
+#define GL_NEGATE_BIT_ATI 0x00000004
+#define GL_BIAS_BIT_ATI 0x00000008
+#endif
+
+#ifndef GL_ATI_pn_triangles
+#define GL_PN_TRIANGLES_ATI 0x87F0
+#define GL_MAX_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F1
+#define GL_PN_TRIANGLES_POINT_MODE_ATI 0x87F2
+#define GL_PN_TRIANGLES_NORMAL_MODE_ATI 0x87F3
+#define GL_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F4
+#define GL_PN_TRIANGLES_POINT_MODE_LINEAR_ATI 0x87F5
+#define GL_PN_TRIANGLES_POINT_MODE_CUBIC_ATI 0x87F6
+#define GL_PN_TRIANGLES_NORMAL_MODE_LINEAR_ATI 0x87F7
+#define GL_PN_TRIANGLES_NORMAL_MODE_QUADRATIC_ATI 0x87F8
+#endif
+
+#ifndef GL_ATI_vertex_array_object
+#define GL_STATIC_ATI 0x8760
+#define GL_DYNAMIC_ATI 0x8761
+#define GL_PRESERVE_ATI 0x8762
+#define GL_DISCARD_ATI 0x8763
+#define GL_OBJECT_BUFFER_SIZE_ATI 0x8764
+#define GL_OBJECT_BUFFER_USAGE_ATI 0x8765
+#define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766
+#define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767
+#endif
+
+#ifndef GL_EXT_vertex_shader
+#define GL_VERTEX_SHADER_EXT 0x8780
+#define GL_VERTEX_SHADER_BINDING_EXT 0x8781
+#define GL_OP_INDEX_EXT 0x8782
+#define GL_OP_NEGATE_EXT 0x8783
+#define GL_OP_DOT3_EXT 0x8784
+#define GL_OP_DOT4_EXT 0x8785
+#define GL_OP_MUL_EXT 0x8786
+#define GL_OP_ADD_EXT 0x8787
+#define GL_OP_MADD_EXT 0x8788
+#define GL_OP_FRAC_EXT 0x8789
+#define GL_OP_MAX_EXT 0x878A
+#define GL_OP_MIN_EXT 0x878B
+#define GL_OP_SET_GE_EXT 0x878C
+#define GL_OP_SET_LT_EXT 0x878D
+#define GL_OP_CLAMP_EXT 0x878E
+#define GL_OP_FLOOR_EXT 0x878F
+#define GL_OP_ROUND_EXT 0x8790
+#define GL_OP_EXP_BASE_2_EXT 0x8791
+#define GL_OP_LOG_BASE_2_EXT 0x8792
+#define GL_OP_POWER_EXT 0x8793
+#define GL_OP_RECIP_EXT 0x8794
+#define GL_OP_RECIP_SQRT_EXT 0x8795
+#define GL_OP_SUB_EXT 0x8796
+#define GL_OP_CROSS_PRODUCT_EXT 0x8797
+#define GL_OP_MULTIPLY_MATRIX_EXT 0x8798
+#define GL_OP_MOV_EXT 0x8799
+#define GL_OUTPUT_VERTEX_EXT 0x879A
+#define GL_OUTPUT_COLOR0_EXT 0x879B
+#define GL_OUTPUT_COLOR1_EXT 0x879C
+#define GL_OUTPUT_TEXTURE_COORD0_EXT 0x879D
+#define GL_OUTPUT_TEXTURE_COORD1_EXT 0x879E
+#define GL_OUTPUT_TEXTURE_COORD2_EXT 0x879F
+#define GL_OUTPUT_TEXTURE_COORD3_EXT 0x87A0
+#define GL_OUTPUT_TEXTURE_COORD4_EXT 0x87A1
+#define GL_OUTPUT_TEXTURE_COORD5_EXT 0x87A2
+#define GL_OUTPUT_TEXTURE_COORD6_EXT 0x87A3
+#define GL_OUTPUT_TEXTURE_COORD7_EXT 0x87A4
+#define GL_OUTPUT_TEXTURE_COORD8_EXT 0x87A5
+#define GL_OUTPUT_TEXTURE_COORD9_EXT 0x87A6
+#define GL_OUTPUT_TEXTURE_COORD10_EXT 0x87A7
+#define GL_OUTPUT_TEXTURE_COORD11_EXT 0x87A8
+#define GL_OUTPUT_TEXTURE_COORD12_EXT 0x87A9
+#define GL_OUTPUT_TEXTURE_COORD13_EXT 0x87AA
+#define GL_OUTPUT_TEXTURE_COORD14_EXT 0x87AB
+#define GL_OUTPUT_TEXTURE_COORD15_EXT 0x87AC
+#define GL_OUTPUT_TEXTURE_COORD16_EXT 0x87AD
+#define GL_OUTPUT_TEXTURE_COORD17_EXT 0x87AE
+#define GL_OUTPUT_TEXTURE_COORD18_EXT 0x87AF
+#define GL_OUTPUT_TEXTURE_COORD19_EXT 0x87B0
+#define GL_OUTPUT_TEXTURE_COORD20_EXT 0x87B1
+#define GL_OUTPUT_TEXTURE_COORD21_EXT 0x87B2
+#define GL_OUTPUT_TEXTURE_COORD22_EXT 0x87B3
+#define GL_OUTPUT_TEXTURE_COORD23_EXT 0x87B4
+#define GL_OUTPUT_TEXTURE_COORD24_EXT 0x87B5
+#define GL_OUTPUT_TEXTURE_COORD25_EXT 0x87B6
+#define GL_OUTPUT_TEXTURE_COORD26_EXT 0x87B7
+#define GL_OUTPUT_TEXTURE_COORD27_EXT 0x87B8
+#define GL_OUTPUT_TEXTURE_COORD28_EXT 0x87B9
+#define GL_OUTPUT_TEXTURE_COORD29_EXT 0x87BA
+#define GL_OUTPUT_TEXTURE_COORD30_EXT 0x87BB
+#define GL_OUTPUT_TEXTURE_COORD31_EXT 0x87BC
+#define GL_OUTPUT_FOG_EXT 0x87BD
+#define GL_SCALAR_EXT 0x87BE
+#define GL_VECTOR_EXT 0x87BF
+#define GL_MATRIX_EXT 0x87C0
+#define GL_VARIANT_EXT 0x87C1
+#define GL_INVARIANT_EXT 0x87C2
+#define GL_LOCAL_CONSTANT_EXT 0x87C3
+#define GL_LOCAL_EXT 0x87C4
+#define GL_MAX_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87C5
+#define GL_MAX_VERTEX_SHADER_VARIANTS_EXT 0x87C6
+#define GL_MAX_VERTEX_SHADER_INVARIANTS_EXT 0x87C7
+#define GL_MAX_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87C8
+#define GL_MAX_VERTEX_SHADER_LOCALS_EXT 0x87C9
+#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CA
+#define GL_MAX_OPTIMIZED_VERTEX_SHADER_VARIANTS_EXT 0x87CB
+#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87CC
+#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INVARIANTS_EXT 0x87CD
+#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCALS_EXT 0x87CE
+#define GL_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CF
+#define GL_VERTEX_SHADER_VARIANTS_EXT 0x87D0
+#define GL_VERTEX_SHADER_INVARIANTS_EXT 0x87D1
+#define GL_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87D2
+#define GL_VERTEX_SHADER_LOCALS_EXT 0x87D3
+#define GL_VERTEX_SHADER_OPTIMIZED_EXT 0x87D4
+#define GL_X_EXT 0x87D5
+#define GL_Y_EXT 0x87D6
+#define GL_Z_EXT 0x87D7
+#define GL_W_EXT 0x87D8
+#define GL_NEGATIVE_X_EXT 0x87D9
+#define GL_NEGATIVE_Y_EXT 0x87DA
+#define GL_NEGATIVE_Z_EXT 0x87DB
+#define GL_NEGATIVE_W_EXT 0x87DC
+#define GL_ZERO_EXT 0x87DD
+#define GL_ONE_EXT 0x87DE
+#define GL_NEGATIVE_ONE_EXT 0x87DF
+#define GL_NORMALIZED_RANGE_EXT 0x87E0
+#define GL_FULL_RANGE_EXT 0x87E1
+#define GL_CURRENT_VERTEX_EXT 0x87E2
+#define GL_MVP_MATRIX_EXT 0x87E3
+#define GL_VARIANT_VALUE_EXT 0x87E4
+#define GL_VARIANT_DATATYPE_EXT 0x87E5
+#define GL_VARIANT_ARRAY_STRIDE_EXT 0x87E6
+#define GL_VARIANT_ARRAY_TYPE_EXT 0x87E7
+#define GL_VARIANT_ARRAY_EXT 0x87E8
+#define GL_VARIANT_ARRAY_POINTER_EXT 0x87E9
+#define GL_INVARIANT_VALUE_EXT 0x87EA
+#define GL_INVARIANT_DATATYPE_EXT 0x87EB
+#define GL_LOCAL_CONSTANT_VALUE_EXT 0x87EC
+#define GL_LOCAL_CONSTANT_DATATYPE_EXT 0x87ED
+#endif
+
+#ifndef GL_ATI_vertex_streams
+#define GL_MAX_VERTEX_STREAMS_ATI 0x876B
+#define GL_VERTEX_STREAM0_ATI 0x876C
+#define GL_VERTEX_STREAM1_ATI 0x876D
+#define GL_VERTEX_STREAM2_ATI 0x876E
+#define GL_VERTEX_STREAM3_ATI 0x876F
+#define GL_VERTEX_STREAM4_ATI 0x8770
+#define GL_VERTEX_STREAM5_ATI 0x8771
+#define GL_VERTEX_STREAM6_ATI 0x8772
+#define GL_VERTEX_STREAM7_ATI 0x8773
+#define GL_VERTEX_SOURCE_ATI 0x8774
+#endif
+
+#ifndef GL_ATI_element_array
+#define GL_ELEMENT_ARRAY_ATI 0x8768
+#define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769
+#define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A
+#endif
+
+#ifndef GL_SUN_mesh_array
+#define GL_QUAD_MESH_SUN 0x8614
+#define GL_TRIANGLE_MESH_SUN 0x8615
+#endif
+
+#ifndef GL_SUN_slice_accum
+#define GL_SLICE_ACCUM_SUN 0x85CC
+#endif
+
+#ifndef GL_NV_multisample_filter_hint
+#define GL_MULTISAMPLE_FILTER_HINT_NV 0x8534
+#endif
+
+#ifndef GL_NV_depth_clamp
+#define GL_DEPTH_CLAMP_NV 0x864F
+#endif
+
+#ifndef GL_NV_occlusion_query
+#define GL_PIXEL_COUNTER_BITS_NV 0x8864
+#define GL_CURRENT_OCCLUSION_QUERY_ID_NV 0x8865
+#define GL_PIXEL_COUNT_NV 0x8866
+#define GL_PIXEL_COUNT_AVAILABLE_NV 0x8867
+#endif
+
+#ifndef GL_NV_point_sprite
+#define GL_POINT_SPRITE_NV 0x8861
+#define GL_COORD_REPLACE_NV 0x8862
+#define GL_POINT_SPRITE_R_MODE_NV 0x8863
+#endif
+
+#ifndef GL_NV_texture_shader3
+#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850
+#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851
+#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852
+#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853
+#define GL_OFFSET_HILO_TEXTURE_2D_NV 0x8854
+#define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855
+#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856
+#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857
+#define GL_DEPENDENT_HILO_TEXTURE_2D_NV 0x8858
+#define GL_DEPENDENT_RGB_TEXTURE_3D_NV 0x8859
+#define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A
+#define GL_DOT_PRODUCT_PASS_THROUGH_NV 0x885B
+#define GL_DOT_PRODUCT_TEXTURE_1D_NV 0x885C
+#define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D
+#define GL_HILO8_NV 0x885E
+#define GL_SIGNED_HILO8_NV 0x885F
+#define GL_FORCE_BLUE_TO_ONE_NV 0x8860
+#endif
+
+#ifndef GL_NV_vertex_program1_1
+#endif
+
+#ifndef GL_EXT_shadow_funcs
+#endif
+
+#ifndef GL_EXT_stencil_two_side
+#define GL_STENCIL_TEST_TWO_SIDE_EXT 0x8910
+#define GL_ACTIVE_STENCIL_FACE_EXT 0x8911
+#endif
+
+#ifndef GL_ATI_text_fragment_shader
+#define GL_TEXT_FRAGMENT_SHADER_ATI 0x8200
+#endif
+
+#ifndef GL_APPLE_client_storage
+#define GL_UNPACK_CLIENT_STORAGE_APPLE 0x85B2
+#endif
+
+#ifndef GL_APPLE_element_array
+#define GL_ELEMENT_ARRAY_APPLE 0x8768
+#define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8769
+#define GL_ELEMENT_ARRAY_POINTER_APPLE 0x876A
+#endif
+
+#ifndef GL_APPLE_fence
+#define GL_DRAW_PIXELS_APPLE 0x8A0A
+#define GL_FENCE_APPLE 0x8A0B
+#endif
+
+#ifndef GL_APPLE_vertex_array_object
+#define GL_VERTEX_ARRAY_BINDING_APPLE 0x85B5
+#endif
+
+#ifndef GL_APPLE_vertex_array_range
+#define GL_VERTEX_ARRAY_RANGE_APPLE 0x851D
+#define GL_VERTEX_ARRAY_RANGE_LENGTH_APPLE 0x851E
+#define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F
+#define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521
+#define GL_STORAGE_CACHED_APPLE 0x85BE
+#define GL_STORAGE_SHARED_APPLE 0x85BF
+#endif
+
+#ifndef GL_APPLE_ycbcr_422
+#define GL_YCBCR_422_APPLE 0x85B9
+#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA
+#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB
+#endif
+
+#ifndef GL_S3_s3tc
+#define GL_RGB_S3TC 0x83A0
+#define GL_RGB4_S3TC 0x83A1
+#define GL_RGBA_S3TC 0x83A2
+#define GL_RGBA4_S3TC 0x83A3
+#endif
+
+#ifndef GL_ATI_draw_buffers
+#define GL_MAX_DRAW_BUFFERS_ATI 0x8824
+#define GL_DRAW_BUFFER0_ATI 0x8825
+#define GL_DRAW_BUFFER1_ATI 0x8826
+#define GL_DRAW_BUFFER2_ATI 0x8827
+#define GL_DRAW_BUFFER3_ATI 0x8828
+#define GL_DRAW_BUFFER4_ATI 0x8829
+#define GL_DRAW_BUFFER5_ATI 0x882A
+#define GL_DRAW_BUFFER6_ATI 0x882B
+#define GL_DRAW_BUFFER7_ATI 0x882C
+#define GL_DRAW_BUFFER8_ATI 0x882D
+#define GL_DRAW_BUFFER9_ATI 0x882E
+#define GL_DRAW_BUFFER10_ATI 0x882F
+#define GL_DRAW_BUFFER11_ATI 0x8830
+#define GL_DRAW_BUFFER12_ATI 0x8831
+#define GL_DRAW_BUFFER13_ATI 0x8832
+#define GL_DRAW_BUFFER14_ATI 0x8833
+#define GL_DRAW_BUFFER15_ATI 0x8834
+#endif
+
+#ifndef GL_ATI_pixel_format_float
+#define GL_TYPE_RGBA_FLOAT_ATI 0x8820
+#define GL_COLOR_CLEAR_UNCLAMPED_VALUE_ATI 0x8835
+#endif
+
+#ifndef GL_ATI_texture_env_combine3
+#define GL_MODULATE_ADD_ATI 0x8744
+#define GL_MODULATE_SIGNED_ADD_ATI 0x8745
+#define GL_MODULATE_SUBTRACT_ATI 0x8746
+#endif
+
+#ifndef GL_ATI_texture_float
+#define GL_RGBA_FLOAT32_ATI 0x8814
+#define GL_RGB_FLOAT32_ATI 0x8815
+#define GL_ALPHA_FLOAT32_ATI 0x8816
+#define GL_INTENSITY_FLOAT32_ATI 0x8817
+#define GL_LUMINANCE_FLOAT32_ATI 0x8818
+#define GL_LUMINANCE_ALPHA_FLOAT32_ATI 0x8819
+#define GL_RGBA_FLOAT16_ATI 0x881A
+#define GL_RGB_FLOAT16_ATI 0x881B
+#define GL_ALPHA_FLOAT16_ATI 0x881C
+#define GL_INTENSITY_FLOAT16_ATI 0x881D
+#define GL_LUMINANCE_FLOAT16_ATI 0x881E
+#define GL_LUMINANCE_ALPHA_FLOAT16_ATI 0x881F
+#endif
+
+#ifndef GL_NV_float_buffer
+#define GL_FLOAT_R_NV 0x8880
+#define GL_FLOAT_RG_NV 0x8881
+#define GL_FLOAT_RGB_NV 0x8882
+#define GL_FLOAT_RGBA_NV 0x8883
+#define GL_FLOAT_R16_NV 0x8884
+#define GL_FLOAT_R32_NV 0x8885
+#define GL_FLOAT_RG16_NV 0x8886
+#define GL_FLOAT_RG32_NV 0x8887
+#define GL_FLOAT_RGB16_NV 0x8888
+#define GL_FLOAT_RGB32_NV 0x8889
+#define GL_FLOAT_RGBA16_NV 0x888A
+#define GL_FLOAT_RGBA32_NV 0x888B
+#define GL_TEXTURE_FLOAT_COMPONENTS_NV 0x888C
+#define GL_FLOAT_CLEAR_COLOR_VALUE_NV 0x888D
+#define GL_FLOAT_RGBA_MODE_NV 0x888E
+#endif
+
+#ifndef GL_NV_fragment_program
+#define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868
+#define GL_FRAGMENT_PROGRAM_NV 0x8870
+#define GL_MAX_TEXTURE_COORDS_NV 0x8871
+#define GL_MAX_TEXTURE_IMAGE_UNITS_NV 0x8872
+#define GL_FRAGMENT_PROGRAM_BINDING_NV 0x8873
+#define GL_PROGRAM_ERROR_STRING_NV 0x8874
+#endif
+
+#ifndef GL_NV_half_float
+#define GL_HALF_FLOAT_NV 0x140B
+#endif
+
+#ifndef GL_NV_pixel_data_range
+#define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878
+#define GL_READ_PIXEL_DATA_RANGE_NV 0x8879
+#define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A
+#define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B
+#define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C
+#define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D
+#endif
+
+#ifndef GL_NV_primitive_restart
+#define GL_PRIMITIVE_RESTART_NV 0x8558
+#define GL_PRIMITIVE_RESTART_INDEX_NV 0x8559
+#endif
+
+#ifndef GL_NV_texture_expand_normal
+#define GL_TEXTURE_UNSIGNED_REMAP_MODE_NV 0x888F
+#endif
+
+#ifndef GL_NV_vertex_program2
+#endif
+
+#ifndef GL_ATI_map_object_buffer
+#endif
+
+#ifndef GL_ATI_separate_stencil
+#define GL_STENCIL_BACK_FUNC_ATI 0x8800
+#define GL_STENCIL_BACK_FAIL_ATI 0x8801
+#define GL_STENCIL_BACK_PASS_DEPTH_FAIL_ATI 0x8802
+#define GL_STENCIL_BACK_PASS_DEPTH_PASS_ATI 0x8803
+#endif
+
+#ifndef GL_ATI_vertex_attrib_array_object
+#endif
+
+#ifndef GL_OES_read_format
+#define GL_IMPLEMENTATION_COLOR_READ_TYPE_OES 0x8B9A
+#define GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES 0x8B9B
+#endif
+
+#ifndef GL_EXT_depth_bounds_test
+#define GL_DEPTH_BOUNDS_TEST_EXT 0x8890
+#define GL_DEPTH_BOUNDS_EXT 0x8891
+#endif
+
+#ifndef GL_EXT_texture_mirror_clamp
+#define GL_MIRROR_CLAMP_EXT 0x8742
+#define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743
+#define GL_MIRROR_CLAMP_TO_BORDER_EXT 0x8912
+#endif
+
+#ifndef GL_EXT_blend_equation_separate
+#define GL_BLEND_EQUATION_RGB_EXT GL_BLEND_EQUATION
+#define GL_BLEND_EQUATION_ALPHA_EXT 0x883D
+#endif
+
+#ifndef GL_MESA_pack_invert
+#define GL_PACK_INVERT_MESA 0x8758
+#endif
+
+#ifndef GL_MESA_ycbcr_texture
+#define GL_UNSIGNED_SHORT_8_8_MESA 0x85BA
+#define GL_UNSIGNED_SHORT_8_8_REV_MESA 0x85BB
+#define GL_YCBCR_MESA 0x8757
+#endif
+
+#ifndef GL_EXT_pixel_buffer_object
+#define GL_PIXEL_PACK_BUFFER_EXT 0x88EB
+#define GL_PIXEL_UNPACK_BUFFER_EXT 0x88EC
+#define GL_PIXEL_PACK_BUFFER_BINDING_EXT 0x88ED
+#define GL_PIXEL_UNPACK_BUFFER_BINDING_EXT 0x88EF
+#endif
+
+#ifndef GL_NV_fragment_program_option
+#endif
+
+#ifndef GL_NV_fragment_program2
+#define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4
+#define GL_MAX_PROGRAM_CALL_DEPTH_NV 0x88F5
+#define GL_MAX_PROGRAM_IF_DEPTH_NV 0x88F6
+#define GL_MAX_PROGRAM_LOOP_DEPTH_NV 0x88F7
+#define GL_MAX_PROGRAM_LOOP_COUNT_NV 0x88F8
+#endif
+
+#ifndef GL_NV_vertex_program2_option
+/* reuse GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV */
+/* reuse GL_MAX_PROGRAM_CALL_DEPTH_NV */
+#endif
+
+#ifndef GL_NV_vertex_program3
+/* reuse GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB */
+#endif
+
+#ifndef GL_EXT_framebuffer_object
+#define GL_INVALID_FRAMEBUFFER_OPERATION_EXT 0x0506
+#define GL_MAX_RENDERBUFFER_SIZE_EXT 0x84E8
+#define GL_FRAMEBUFFER_BINDING_EXT 0x8CA6
+#define GL_RENDERBUFFER_BINDING_EXT 0x8CA7
+#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE_EXT 0x8CD0
+#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME_EXT 0x8CD1
+#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL_EXT 0x8CD2
+#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE_EXT 0x8CD3
+#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_EXT 0x8CD4
+#define GL_FRAMEBUFFER_COMPLETE_EXT 0x8CD5
+#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT_EXT 0x8CD6
+#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT_EXT 0x8CD7
+#define GL_FRAMEBUFFER_INCOMPLETE_DUPLICATE_ATTACHMENT_EXT 0x8CD8
+#define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS_EXT 0x8CD9
+#define GL_FRAMEBUFFER_INCOMPLETE_FORMATS_EXT 0x8CDA
+#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER_EXT 0x8CDB
+#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER_EXT 0x8CDC
+#define GL_FRAMEBUFFER_UNSUPPORTED_EXT 0x8CDD
+#define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF
+#define GL_COLOR_ATTACHMENT0_EXT 0x8CE0
+#define GL_COLOR_ATTACHMENT1_EXT 0x8CE1
+#define GL_COLOR_ATTACHMENT2_EXT 0x8CE2
+#define GL_COLOR_ATTACHMENT3_EXT 0x8CE3
+#define GL_COLOR_ATTACHMENT4_EXT 0x8CE4
+#define GL_COLOR_ATTACHMENT5_EXT 0x8CE5
+#define GL_COLOR_ATTACHMENT6_EXT 0x8CE6
+#define GL_COLOR_ATTACHMENT7_EXT 0x8CE7
+#define GL_COLOR_ATTACHMENT8_EXT 0x8CE8
+#define GL_COLOR_ATTACHMENT9_EXT 0x8CE9
+#define GL_COLOR_ATTACHMENT10_EXT 0x8CEA
+#define GL_COLOR_ATTACHMENT11_EXT 0x8CEB
+#define GL_COLOR_ATTACHMENT12_EXT 0x8CEC
+#define GL_COLOR_ATTACHMENT13_EXT 0x8CED
+#define GL_COLOR_ATTACHMENT14_EXT 0x8CEE
+#define GL_COLOR_ATTACHMENT15_EXT 0x8CEF
+#define GL_DEPTH_ATTACHMENT_EXT 0x8D00
+#define GL_STENCIL_ATTACHMENT_EXT 0x8D20
+#define GL_FRAMEBUFFER_EXT 0x8D40
+#define GL_RENDERBUFFER_EXT 0x8D41
+#define GL_RENDERBUFFER_WIDTH_EXT 0x8D42
+#define GL_RENDERBUFFER_HEIGHT_EXT 0x8D43
+#define GL_RENDERBUFFER_INTERNAL_FORMAT_EXT 0x8D44
+#define GL_STENCIL_INDEX1_EXT 0x8D46
+#define GL_STENCIL_INDEX4_EXT 0x8D47
+#define GL_STENCIL_INDEX8_EXT 0x8D48
+#define GL_STENCIL_INDEX16_EXT 0x8D49
+#define GL_RENDERBUFFER_RED_SIZE_EXT 0x8D50
+#define GL_RENDERBUFFER_GREEN_SIZE_EXT 0x8D51
+#define GL_RENDERBUFFER_BLUE_SIZE_EXT 0x8D52
+#define GL_RENDERBUFFER_ALPHA_SIZE_EXT 0x8D53
+#define GL_RENDERBUFFER_DEPTH_SIZE_EXT 0x8D54
+#define GL_RENDERBUFFER_STENCIL_SIZE_EXT 0x8D55
+#endif
+
+#ifndef GL_GREMEDY_string_marker
+#endif
+
+
+/*************************************************************/
+
+#include
+#ifndef GL_VERSION_2_0
+/* GL type for program/shader text */
+typedef char GLchar; /* native character */
+#endif
+
+#ifndef GL_VERSION_1_5
+/* GL types for handling large vertex buffer objects */
+typedef ptrdiff_t GLintptr;
+typedef ptrdiff_t GLsizeiptr;
+#endif
+
+#ifndef GL_ARB_vertex_buffer_object
+/* GL types for handling large vertex buffer objects */
+typedef ptrdiff_t GLintptrARB;
+typedef ptrdiff_t GLsizeiptrARB;
+#endif
+
+#ifndef GL_ARB_shader_objects
+/* GL types for handling shader object handles and program/shader text */
+typedef char GLcharARB; /* native character */
+typedef unsigned int GLhandleARB; /* shader object handle */
+#endif
+
+/* GL types for "half" precision (s10e5) float data in host memory */
+#ifndef GL_ARB_half_float_pixel
+typedef unsigned short GLhalfARB;
+#endif
+
+#ifndef GL_NV_half_float
+typedef unsigned short GLhalfNV;
+#endif
+
+#ifndef GL_VERSION_1_2
+#define GL_VERSION_1_2 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBlendColor (GLclampf, GLclampf, GLclampf, GLclampf);
+GLAPI void APIENTRY glBlendEquation (GLenum);
+GLAPI void APIENTRY glDrawRangeElements (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *);
+GLAPI void APIENTRY glColorTable (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glColorTableParameterfv (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glColorTableParameteriv (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glCopyColorTable (GLenum, GLenum, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glGetColorTable (GLenum, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetColorTableParameterfv (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetColorTableParameteriv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glColorSubTable (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glCopyColorSubTable (GLenum, GLsizei, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glConvolutionFilter1D (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glConvolutionFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glConvolutionParameterf (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glConvolutionParameterfv (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glConvolutionParameteri (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glConvolutionParameteriv (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum, GLenum, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei);
+GLAPI void APIENTRY glGetConvolutionFilter (GLenum, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetSeparableFilter (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *);
+GLAPI void APIENTRY glSeparableFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *);
+GLAPI void APIENTRY glGetHistogram (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetHistogramParameterfv (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetHistogramParameteriv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetMinmax (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glHistogram (GLenum, GLsizei, GLenum, GLboolean);
+GLAPI void APIENTRY glMinmax (GLenum, GLenum, GLboolean);
+GLAPI void APIENTRY glResetHistogram (GLenum);
+GLAPI void APIENTRY glResetMinmax (GLenum);
+GLAPI void APIENTRY glTexImage3D (GLenum, GLint, GLint, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glCopyTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode);
+typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
+typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
+typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
+typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
+typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
+typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink);
+typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+#endif
+
+#ifndef GL_VERSION_1_3
+#define GL_VERSION_1_3 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glActiveTexture (GLenum);
+GLAPI void APIENTRY glClientActiveTexture (GLenum);
+GLAPI void APIENTRY glMultiTexCoord1d (GLenum, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord1dv (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord1f (GLenum, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord1fv (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord1i (GLenum, GLint);
+GLAPI void APIENTRY glMultiTexCoord1iv (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord1s (GLenum, GLshort);
+GLAPI void APIENTRY glMultiTexCoord1sv (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord2d (GLenum, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord2dv (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord2f (GLenum, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord2fv (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord2i (GLenum, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord2iv (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord2s (GLenum, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord2sv (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord3d (GLenum, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord3dv (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord3f (GLenum, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord3fv (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord3i (GLenum, GLint, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord3iv (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord3s (GLenum, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord3sv (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord4d (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord4dv (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord4f (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord4fv (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord4i (GLenum, GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord4iv (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord4s (GLenum, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord4sv (GLenum, const GLshort *);
+GLAPI void APIENTRY glLoadTransposeMatrixf (const GLfloat *);
+GLAPI void APIENTRY glLoadTransposeMatrixd (const GLdouble *);
+GLAPI void APIENTRY glMultTransposeMatrixf (const GLfloat *);
+GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *);
+GLAPI void APIENTRY glSampleCoverage (GLclampf, GLboolean);
+GLAPI void APIENTRY glCompressedTexImage3D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexImage2D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexImage1D (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glGetCompressedTexImage (GLenum, GLint, GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture);
+typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m);
+typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m);
+typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m);
+typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m);
+typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img);
+#endif
+
+#ifndef GL_VERSION_1_4
+#define GL_VERSION_1_4 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBlendFuncSeparate (GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glFogCoordf (GLfloat);
+GLAPI void APIENTRY glFogCoordfv (const GLfloat *);
+GLAPI void APIENTRY glFogCoordd (GLdouble);
+GLAPI void APIENTRY glFogCoorddv (const GLdouble *);
+GLAPI void APIENTRY glFogCoordPointer (GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glMultiDrawArrays (GLenum, GLint *, GLsizei *, GLsizei);
+GLAPI void APIENTRY glMultiDrawElements (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei);
+GLAPI void APIENTRY glPointParameterf (GLenum, GLfloat);
+GLAPI void APIENTRY glPointParameterfv (GLenum, const GLfloat *);
+GLAPI void APIENTRY glPointParameteri (GLenum, GLint);
+GLAPI void APIENTRY glPointParameteriv (GLenum, const GLint *);
+GLAPI void APIENTRY glSecondaryColor3b (GLbyte, GLbyte, GLbyte);
+GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *);
+GLAPI void APIENTRY glSecondaryColor3d (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glSecondaryColor3dv (const GLdouble *);
+GLAPI void APIENTRY glSecondaryColor3f (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glSecondaryColor3fv (const GLfloat *);
+GLAPI void APIENTRY glSecondaryColor3i (GLint, GLint, GLint);
+GLAPI void APIENTRY glSecondaryColor3iv (const GLint *);
+GLAPI void APIENTRY glSecondaryColor3s (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glSecondaryColor3sv (const GLshort *);
+GLAPI void APIENTRY glSecondaryColor3ub (GLubyte, GLubyte, GLubyte);
+GLAPI void APIENTRY glSecondaryColor3ubv (const GLubyte *);
+GLAPI void APIENTRY glSecondaryColor3ui (GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *);
+GLAPI void APIENTRY glSecondaryColor3us (GLushort, GLushort, GLushort);
+GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *);
+GLAPI void APIENTRY glSecondaryColorPointer (GLint, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glWindowPos2d (GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos2dv (const GLdouble *);
+GLAPI void APIENTRY glWindowPos2f (GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos2fv (const GLfloat *);
+GLAPI void APIENTRY glWindowPos2i (GLint, GLint);
+GLAPI void APIENTRY glWindowPos2iv (const GLint *);
+GLAPI void APIENTRY glWindowPos2s (GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos2sv (const GLshort *);
+GLAPI void APIENTRY glWindowPos3d (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos3dv (const GLdouble *);
+GLAPI void APIENTRY glWindowPos3f (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos3fv (const GLfloat *);
+GLAPI void APIENTRY glWindowPos3i (GLint, GLint, GLint);
+GLAPI void APIENTRY glWindowPos3iv (const GLint *);
+GLAPI void APIENTRY glWindowPos3s (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos3sv (const GLshort *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord);
+typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord);
+typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord);
+typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord);
+typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount);
+typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FVPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2IPROC) (GLint x, GLint y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2IVPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SVPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DVPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FVPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v);
+#endif
+
+#ifndef GL_VERSION_1_5
+#define GL_VERSION_1_5 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glGenQueries (GLsizei, GLuint *);
+GLAPI void APIENTRY glDeleteQueries (GLsizei, const GLuint *);
+GLAPI GLboolean APIENTRY glIsQuery (GLuint);
+GLAPI void APIENTRY glBeginQuery (GLenum, GLuint);
+GLAPI void APIENTRY glEndQuery (GLenum);
+GLAPI void APIENTRY glGetQueryiv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetQueryObjectiv (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetQueryObjectuiv (GLuint, GLenum, GLuint *);
+GLAPI void APIENTRY glBindBuffer (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteBuffers (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenBuffers (GLsizei, GLuint *);
+GLAPI GLboolean APIENTRY glIsBuffer (GLuint);
+GLAPI void APIENTRY glBufferData (GLenum, GLsizeiptr, const GLvoid *, GLenum);
+GLAPI void APIENTRY glBufferSubData (GLenum, GLintptr, GLsizeiptr, const GLvoid *);
+GLAPI void APIENTRY glGetBufferSubData (GLenum, GLintptr, GLsizeiptr, GLvoid *);
+GLAPI GLvoid* APIENTRY glMapBuffer (GLenum, GLenum);
+GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum);
+GLAPI void APIENTRY glGetBufferParameteriv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetBufferPointerv (GLenum, GLenum, GLvoid* *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids);
+typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids);
+typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id);
+typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id);
+typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params);
+typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer);
+typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers);
+typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers);
+typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer);
+typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage);
+typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data);
+typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data);
+typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access);
+typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid* *params);
+#endif
+
+#ifndef GL_VERSION_2_0
+#define GL_VERSION_2_0 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBlendEquationSeparate (GLenum, GLenum);
+GLAPI void APIENTRY glDrawBuffers (GLsizei, const GLenum *);
+GLAPI void APIENTRY glStencilOpSeparate (GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glStencilFuncSeparate (GLenum, GLenum, GLint, GLuint);
+GLAPI void APIENTRY glStencilMaskSeparate (GLenum, GLuint);
+GLAPI void APIENTRY glAttachShader (GLuint, GLuint);
+GLAPI void APIENTRY glBindAttribLocation (GLuint, GLuint, const GLchar *);
+GLAPI void APIENTRY glCompileShader (GLuint);
+GLAPI GLuint APIENTRY glCreateProgram (void);
+GLAPI GLuint APIENTRY glCreateShader (GLenum);
+GLAPI void APIENTRY glDeleteProgram (GLuint);
+GLAPI void APIENTRY glDeleteShader (GLuint);
+GLAPI void APIENTRY glDetachShader (GLuint, GLuint);
+GLAPI void APIENTRY glDisableVertexAttribArray (GLuint);
+GLAPI void APIENTRY glEnableVertexAttribArray (GLuint);
+GLAPI void APIENTRY glGetActiveAttrib (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *);
+GLAPI void APIENTRY glGetActiveUniform (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *);
+GLAPI void APIENTRY glGetAttachedShaders (GLuint, GLsizei, GLsizei *, GLuint *);
+GLAPI GLint APIENTRY glGetAttribLocation (GLuint, const GLchar *);
+GLAPI void APIENTRY glGetProgramiv (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetProgramInfoLog (GLuint, GLsizei, GLsizei *, GLchar *);
+GLAPI void APIENTRY glGetShaderiv (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetShaderInfoLog (GLuint, GLsizei, GLsizei *, GLchar *);
+GLAPI void APIENTRY glGetShaderSource (GLuint, GLsizei, GLsizei *, GLchar *);
+GLAPI GLint APIENTRY glGetUniformLocation (GLuint, const GLchar *);
+GLAPI void APIENTRY glGetUniformfv (GLuint, GLint, GLfloat *);
+GLAPI void APIENTRY glGetUniformiv (GLuint, GLint, GLint *);
+GLAPI void APIENTRY glGetVertexAttribdv (GLuint, GLenum, GLdouble *);
+GLAPI void APIENTRY glGetVertexAttribfv (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVertexAttribiv (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint, GLenum, GLvoid* *);
+GLAPI GLboolean APIENTRY glIsProgram (GLuint);
+GLAPI GLboolean APIENTRY glIsShader (GLuint);
+GLAPI void APIENTRY glLinkProgram (GLuint);
+GLAPI void APIENTRY glShaderSource (GLuint, GLsizei, const GLchar* *, const GLint *);
+GLAPI void APIENTRY glUseProgram (GLuint);
+GLAPI void APIENTRY glUniform1f (GLint, GLfloat);
+GLAPI void APIENTRY glUniform2f (GLint, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform3f (GLint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform4f (GLint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform1i (GLint, GLint);
+GLAPI void APIENTRY glUniform2i (GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform3i (GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform4i (GLint, GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform1fv (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform2fv (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform3fv (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform4fv (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform1iv (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform2iv (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform3iv (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform4iv (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniformMatrix2fv (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glUniformMatrix3fv (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glUniformMatrix4fv (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glValidateProgram (GLuint);
+GLAPI void APIENTRY glVertexAttrib1d (GLuint, GLdouble);
+GLAPI void APIENTRY glVertexAttrib1dv (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib1f (GLuint, GLfloat);
+GLAPI void APIENTRY glVertexAttrib1fv (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib1s (GLuint, GLshort);
+GLAPI void APIENTRY glVertexAttrib1sv (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib2d (GLuint, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib2dv (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib2f (GLuint, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib2fv (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib2s (GLuint, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib2sv (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib3d (GLuint, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib3dv (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib3f (GLuint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib3fv (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib3s (GLuint, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib3sv (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint, const GLbyte *);
+GLAPI void APIENTRY glVertexAttrib4Niv (GLuint, const GLint *);
+GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4Nub (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
+GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint, const GLuint *);
+GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint, const GLushort *);
+GLAPI void APIENTRY glVertexAttrib4bv (GLuint, const GLbyte *);
+GLAPI void APIENTRY glVertexAttrib4d (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib4dv (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib4f (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib4fv (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib4iv (GLuint, const GLint *);
+GLAPI void APIENTRY glVertexAttrib4s (GLuint, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib4sv (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4ubv (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVertexAttrib4uiv (GLuint, const GLuint *);
+GLAPI void APIENTRY glVertexAttrib4usv (GLuint, const GLushort *);
+GLAPI void APIENTRY glVertexAttribPointer (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha);
+typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs);
+typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
+typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
+typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask);
+typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader);
+typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name);
+typedef void (APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader);
+typedef GLuint (APIENTRYP PFNGLCREATEPROGRAMPROC) (void);
+typedef GLuint (APIENTRYP PFNGLCREATESHADERPROC) (GLenum type);
+typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program);
+typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader);
+typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader);
+typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index);
+typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index);
+typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name);
+typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name);
+typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *obj);
+typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name);
+typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog);
+typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog);
+typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source);
+typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name);
+typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
+typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program);
+typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader);
+typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program);
+typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar* *string, const GLint *length);
+typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program);
+typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0);
+typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1);
+typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0);
+typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1);
+typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer);
+#endif
+
+#ifndef GL_ARB_multitexture
+#define GL_ARB_multitexture 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glActiveTextureARB (GLenum);
+GLAPI void APIENTRY glClientActiveTextureARB (GLenum);
+GLAPI void APIENTRY glMultiTexCoord1dARB (GLenum, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord1dvARB (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord1fARB (GLenum, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord1fvARB (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord1iARB (GLenum, GLint);
+GLAPI void APIENTRY glMultiTexCoord1ivARB (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord1sARB (GLenum, GLshort);
+GLAPI void APIENTRY glMultiTexCoord1svARB (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord2dARB (GLenum, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord2dvARB (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord2fARB (GLenum, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord2fvARB (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord2iARB (GLenum, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord2ivARB (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord2sARB (GLenum, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord2svARB (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord3dARB (GLenum, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord3dvARB (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord3fARB (GLenum, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord3fvARB (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord3iARB (GLenum, GLint, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord3ivARB (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord3sARB (GLenum, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord3svARB (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord4dARB (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord4dvARB (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord4fARB (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord4fvARB (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord4iARB (GLenum, GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord4ivARB (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord4sARB (GLenum, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord4svARB (GLenum, const GLshort *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLACTIVETEXTUREARBPROC) (GLenum texture);
+typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v);
+#endif
+
+#ifndef GL_ARB_transpose_matrix
+#define GL_ARB_transpose_matrix 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glLoadTransposeMatrixfARB (const GLfloat *);
+GLAPI void APIENTRY glLoadTransposeMatrixdARB (const GLdouble *);
+GLAPI void APIENTRY glMultTransposeMatrixfARB (const GLfloat *);
+GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFARBPROC) (const GLfloat *m);
+typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDARBPROC) (const GLdouble *m);
+typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFARBPROC) (const GLfloat *m);
+typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDARBPROC) (const GLdouble *m);
+#endif
+
+#ifndef GL_ARB_multisample
+#define GL_ARB_multisample 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glSampleCoverageARB (GLclampf, GLboolean);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert);
+#endif
+
+#ifndef GL_ARB_texture_env_add
+#define GL_ARB_texture_env_add 1
+#endif
+
+#ifndef GL_ARB_texture_cube_map
+#define GL_ARB_texture_cube_map 1
+#endif
+
+#ifndef GL_ARB_texture_compression
+#define GL_ARB_texture_compression 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum, GLint, GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img);
+#endif
+
+#ifndef GL_ARB_texture_border_clamp
+#define GL_ARB_texture_border_clamp 1
+#endif
+
+#ifndef GL_ARB_point_parameters
+#define GL_ARB_point_parameters 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPointParameterfARB (GLenum, GLfloat);
+GLAPI void APIENTRY glPointParameterfvARB (GLenum, const GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params);
+#endif
+
+#ifndef GL_ARB_vertex_blend
+#define GL_ARB_vertex_blend 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glWeightbvARB (GLint, const GLbyte *);
+GLAPI void APIENTRY glWeightsvARB (GLint, const GLshort *);
+GLAPI void APIENTRY glWeightivARB (GLint, const GLint *);
+GLAPI void APIENTRY glWeightfvARB (GLint, const GLfloat *);
+GLAPI void APIENTRY glWeightdvARB (GLint, const GLdouble *);
+GLAPI void APIENTRY glWeightubvARB (GLint, const GLubyte *);
+GLAPI void APIENTRY glWeightusvARB (GLint, const GLushort *);
+GLAPI void APIENTRY glWeightuivARB (GLint, const GLuint *);
+GLAPI void APIENTRY glWeightPointerARB (GLint, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glVertexBlendARB (GLint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights);
+typedef void (APIENTRYP PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights);
+typedef void (APIENTRYP PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights);
+typedef void (APIENTRYP PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights);
+typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights);
+typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights);
+typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights);
+typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights);
+typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count);
+#endif
+
+#ifndef GL_ARB_matrix_palette
+#define GL_ARB_matrix_palette 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint);
+GLAPI void APIENTRY glMatrixIndexubvARB (GLint, const GLubyte *);
+GLAPI void APIENTRY glMatrixIndexusvARB (GLint, const GLushort *);
+GLAPI void APIENTRY glMatrixIndexuivARB (GLint, const GLuint *);
+GLAPI void APIENTRY glMatrixIndexPointerARB (GLint, GLenum, GLsizei, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index);
+typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices);
+typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices);
+typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices);
+typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+#endif
+
+#ifndef GL_ARB_texture_env_combine
+#define GL_ARB_texture_env_combine 1
+#endif
+
+#ifndef GL_ARB_texture_env_crossbar
+#define GL_ARB_texture_env_crossbar 1
+#endif
+
+#ifndef GL_ARB_texture_env_dot3
+#define GL_ARB_texture_env_dot3 1
+#endif
+
+#ifndef GL_ARB_texture_mirrored_repeat
+#define GL_ARB_texture_mirrored_repeat 1
+#endif
+
+#ifndef GL_ARB_depth_texture
+#define GL_ARB_depth_texture 1
+#endif
+
+#ifndef GL_ARB_shadow
+#define GL_ARB_shadow 1
+#endif
+
+#ifndef GL_ARB_shadow_ambient
+#define GL_ARB_shadow_ambient 1
+#endif
+
+#ifndef GL_ARB_window_pos
+#define GL_ARB_window_pos 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glWindowPos2dARB (GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos2dvARB (const GLdouble *);
+GLAPI void APIENTRY glWindowPos2fARB (GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos2fvARB (const GLfloat *);
+GLAPI void APIENTRY glWindowPos2iARB (GLint, GLint);
+GLAPI void APIENTRY glWindowPos2ivARB (const GLint *);
+GLAPI void APIENTRY glWindowPos2sARB (GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos2svARB (const GLshort *);
+GLAPI void APIENTRY glWindowPos3dARB (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos3dvARB (const GLdouble *);
+GLAPI void APIENTRY glWindowPos3fARB (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos3fvARB (const GLfloat *);
+GLAPI void APIENTRY glWindowPos3iARB (GLint, GLint, GLint);
+GLAPI void APIENTRY glWindowPos3ivARB (const GLint *);
+GLAPI void APIENTRY glWindowPos3sARB (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos3svARB (const GLshort *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2IVARBPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IVARBPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v);
+#endif
+
+#ifndef GL_ARB_vertex_program
+#define GL_ARB_vertex_program 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glVertexAttrib1dARB (GLuint, GLdouble);
+GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib1fARB (GLuint, GLfloat);
+GLAPI void APIENTRY glVertexAttrib1fvARB (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib1sARB (GLuint, GLshort);
+GLAPI void APIENTRY glVertexAttrib1svARB (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib2dARB (GLuint, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib2dvARB (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib2fARB (GLuint, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib2fvARB (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib2sARB (GLuint, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib2svARB (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib3dARB (GLuint, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib3dvARB (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib3fARB (GLuint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib3fvARB (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib3sARB (GLuint, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib3svARB (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4NbvARB (GLuint, const GLbyte *);
+GLAPI void APIENTRY glVertexAttrib4NivARB (GLuint, const GLint *);
+GLAPI void APIENTRY glVertexAttrib4NsvARB (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4NubARB (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
+GLAPI void APIENTRY glVertexAttrib4NubvARB (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVertexAttrib4NuivARB (GLuint, const GLuint *);
+GLAPI void APIENTRY glVertexAttrib4NusvARB (GLuint, const GLushort *);
+GLAPI void APIENTRY glVertexAttrib4bvARB (GLuint, const GLbyte *);
+GLAPI void APIENTRY glVertexAttrib4dARB (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib4dvARB (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib4fARB (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib4fvARB (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib4ivARB (GLuint, const GLint *);
+GLAPI void APIENTRY glVertexAttrib4sARB (GLuint, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib4svARB (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint, const GLuint *);
+GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint, const GLushort *);
+GLAPI void APIENTRY glVertexAttribPointerARB (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint);
+GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint);
+GLAPI void APIENTRY glProgramStringARB (GLenum, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glBindProgramARB (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteProgramsARB (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenProgramsARB (GLsizei, GLuint *);
+GLAPI void APIENTRY glProgramEnvParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glProgramEnvParameter4dvARB (GLenum, GLuint, const GLdouble *);
+GLAPI void APIENTRY glProgramEnvParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glProgramEnvParameter4fvARB (GLenum, GLuint, const GLfloat *);
+GLAPI void APIENTRY glProgramLocalParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glProgramLocalParameter4dvARB (GLenum, GLuint, const GLdouble *);
+GLAPI void APIENTRY glProgramLocalParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glProgramLocalParameter4fvARB (GLenum, GLuint, const GLfloat *);
+GLAPI void APIENTRY glGetProgramEnvParameterdvARB (GLenum, GLuint, GLdouble *);
+GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum, GLuint, GLfloat *);
+GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum, GLuint, GLdouble *);
+GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum, GLuint, GLfloat *);
+GLAPI void APIENTRY glGetProgramivARB (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetProgramStringARB (GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint, GLenum, GLdouble *);
+GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVertexAttribivARB (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint, GLenum, GLvoid* *);
+GLAPI GLboolean APIENTRY glIsProgramARB (GLuint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index);
+typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index);
+typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string);
+typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program);
+typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs);
+typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs);
+typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params);
+typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params);
+typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params);
+typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
+typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program);
+#endif
+
+#ifndef GL_ARB_fragment_program
+#define GL_ARB_fragment_program 1
+/* All ARB_fragment_program entry points are shared with ARB_vertex_program. */
+#endif
+
+#ifndef GL_ARB_vertex_buffer_object
+#define GL_ARB_vertex_buffer_object 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBindBufferARB (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteBuffersARB (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenBuffersARB (GLsizei, GLuint *);
+GLAPI GLboolean APIENTRY glIsBufferARB (GLuint);
+GLAPI void APIENTRY glBufferDataARB (GLenum, GLsizeiptrARB, const GLvoid *, GLenum);
+GLAPI void APIENTRY glBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, const GLvoid *);
+GLAPI void APIENTRY glGetBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, GLvoid *);
+GLAPI GLvoid* APIENTRY glMapBufferARB (GLenum, GLenum);
+GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum);
+GLAPI void APIENTRY glGetBufferParameterivARB (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetBufferPointervARB (GLenum, GLenum, GLvoid* *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer);
+typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers);
+typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers);
+typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer);
+typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage);
+typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data);
+typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data);
+typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access);
+typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid* *params);
+#endif
+
+#ifndef GL_ARB_occlusion_query
+#define GL_ARB_occlusion_query 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glGenQueriesARB (GLsizei, GLuint *);
+GLAPI void APIENTRY glDeleteQueriesARB (GLsizei, const GLuint *);
+GLAPI GLboolean APIENTRY glIsQueryARB (GLuint);
+GLAPI void APIENTRY glBeginQueryARB (GLenum, GLuint);
+GLAPI void APIENTRY glEndQueryARB (GLenum);
+GLAPI void APIENTRY glGetQueryivARB (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetQueryObjectivARB (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint, GLenum, GLuint *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids);
+typedef void (APIENTRYP PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids);
+typedef GLboolean (APIENTRYP PFNGLISQUERYARBPROC) (GLuint id);
+typedef void (APIENTRYP PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id);
+typedef void (APIENTRYP PFNGLENDQUERYARBPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params);
+#endif
+
+#ifndef GL_ARB_shader_objects
+#define GL_ARB_shader_objects 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDeleteObjectARB (GLhandleARB);
+GLAPI GLhandleARB APIENTRY glGetHandleARB (GLenum);
+GLAPI void APIENTRY glDetachObjectARB (GLhandleARB, GLhandleARB);
+GLAPI GLhandleARB APIENTRY glCreateShaderObjectARB (GLenum);
+GLAPI void APIENTRY glShaderSourceARB (GLhandleARB, GLsizei, const GLcharARB* *, const GLint *);
+GLAPI void APIENTRY glCompileShaderARB (GLhandleARB);
+GLAPI GLhandleARB APIENTRY glCreateProgramObjectARB (void);
+GLAPI void APIENTRY glAttachObjectARB (GLhandleARB, GLhandleARB);
+GLAPI void APIENTRY glLinkProgramARB (GLhandleARB);
+GLAPI void APIENTRY glUseProgramObjectARB (GLhandleARB);
+GLAPI void APIENTRY glValidateProgramARB (GLhandleARB);
+GLAPI void APIENTRY glUniform1fARB (GLint, GLfloat);
+GLAPI void APIENTRY glUniform2fARB (GLint, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform3fARB (GLint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform4fARB (GLint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform1iARB (GLint, GLint);
+GLAPI void APIENTRY glUniform2iARB (GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform3iARB (GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform4iARB (GLint, GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform1fvARB (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform2fvARB (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform3fvARB (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform4fvARB (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform1ivARB (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform2ivARB (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform3ivARB (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform4ivARB (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniformMatrix2fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glUniformMatrix3fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glUniformMatrix4fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glGetObjectParameterfvARB (GLhandleARB, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetObjectParameterivARB (GLhandleARB, GLenum, GLint *);
+GLAPI void APIENTRY glGetInfoLogARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *);
+GLAPI void APIENTRY glGetAttachedObjectsARB (GLhandleARB, GLsizei, GLsizei *, GLhandleARB *);
+GLAPI GLint APIENTRY glGetUniformLocationARB (GLhandleARB, const GLcharARB *);
+GLAPI void APIENTRY glGetActiveUniformARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *);
+GLAPI void APIENTRY glGetUniformfvARB (GLhandleARB, GLint, GLfloat *);
+GLAPI void APIENTRY glGetUniformivARB (GLhandleARB, GLint, GLint *);
+GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj);
+typedef GLhandleARB (APIENTRYP PFNGLGETHANDLEARBPROC) (GLenum pname);
+typedef void (APIENTRYP PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj);
+typedef GLhandleARB (APIENTRYP PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType);
+typedef void (APIENTRYP PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length);
+typedef void (APIENTRYP PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj);
+typedef GLhandleARB (APIENTRYP PFNGLCREATEPROGRAMOBJECTARBPROC) (void);
+typedef void (APIENTRYP PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj);
+typedef void (APIENTRYP PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj);
+typedef void (APIENTRYP PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj);
+typedef void (APIENTRYP PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj);
+typedef void (APIENTRYP PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0);
+typedef void (APIENTRYP PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1);
+typedef void (APIENTRYP PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (APIENTRYP PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (APIENTRYP PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0);
+typedef void (APIENTRYP PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1);
+typedef void (APIENTRYP PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (APIENTRYP PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (APIENTRYP PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog);
+typedef void (APIENTRYP PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj);
+typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name);
+typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name);
+typedef void (APIENTRYP PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params);
+typedef void (APIENTRYP PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source);
+#endif
+
+#ifndef GL_ARB_vertex_shader
+#define GL_ARB_vertex_shader 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBindAttribLocationARB (GLhandleARB, GLuint, const GLcharARB *);
+GLAPI void APIENTRY glGetActiveAttribARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *);
+GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB, const GLcharARB *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name);
+typedef void (APIENTRYP PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name);
+typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name);
+#endif
+
+#ifndef GL_ARB_fragment_shader
+#define GL_ARB_fragment_shader 1
+#endif
+
+#ifndef GL_ARB_shading_language_100
+#define GL_ARB_shading_language_100 1
+#endif
+
+#ifndef GL_ARB_texture_non_power_of_two
+#define GL_ARB_texture_non_power_of_two 1
+#endif
+
+#ifndef GL_ARB_point_sprite
+#define GL_ARB_point_sprite 1
+#endif
+
+#ifndef GL_ARB_fragment_program_shadow
+#define GL_ARB_fragment_program_shadow 1
+#endif
+
+#ifndef GL_ARB_draw_buffers
+#define GL_ARB_draw_buffers 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDrawBuffersARB (GLsizei, const GLenum *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs);
+#endif
+
+#ifndef GL_ARB_texture_rectangle
+#define GL_ARB_texture_rectangle 1
+#endif
+
+#ifndef GL_ARB_color_buffer_float
+#define GL_ARB_color_buffer_float 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glClampColorARB (GLenum, GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp);
+#endif
+
+#ifndef GL_ARB_half_float_pixel
+#define GL_ARB_half_float_pixel 1
+#endif
+
+#ifndef GL_ARB_texture_float
+#define GL_ARB_texture_float 1
+#endif
+
+#ifndef GL_ARB_pixel_buffer_object
+#define GL_ARB_pixel_buffer_object 1
+#endif
+
+#ifndef GL_EXT_abgr
+#define GL_EXT_abgr 1
+#endif
+
+#ifndef GL_EXT_blend_color
+#define GL_EXT_blend_color 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBlendColorEXT (GLclampf, GLclampf, GLclampf, GLclampf);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+#endif
+
+#ifndef GL_EXT_polygon_offset
+#define GL_EXT_polygon_offset 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat, GLfloat);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias);
+#endif
+
+#ifndef GL_EXT_texture
+#define GL_EXT_texture 1
+#endif
+
+#ifndef GL_EXT_texture3D
+#define GL_EXT_texture3D 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glTexImage3DEXT (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels);
+#endif
+
+#ifndef GL_SGIS_texture_filter4
+#define GL_SGIS_texture_filter4 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glGetTexFilterFuncSGIS (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glTexFilterFuncSGIS (GLenum, GLenum, GLsizei, const GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights);
+typedef void (APIENTRYP PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights);
+#endif
+
+#ifndef GL_EXT_subtexture
+#define GL_EXT_subtexture 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glTexSubImage1DEXT (GLenum, GLint, GLint, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels);
+#endif
+
+#ifndef GL_EXT_copy_texture
+#define GL_EXT_copy_texture 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glCopyTexImage1DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLint);
+GLAPI void APIENTRY glCopyTexImage2DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLsizei, GLint);
+GLAPI void APIENTRY glCopyTexSubImage1DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glCopyTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
+GLAPI void APIENTRY glCopyTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border);
+typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
+typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+#endif
+
+#ifndef GL_EXT_histogram
+#define GL_EXT_histogram 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glGetHistogramEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetMinmaxEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glHistogramEXT (GLenum, GLsizei, GLenum, GLboolean);
+GLAPI void APIENTRY glMinmaxEXT (GLenum, GLenum, GLboolean);
+GLAPI void APIENTRY glResetHistogramEXT (GLenum);
+GLAPI void APIENTRY glResetMinmaxEXT (GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
+typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink);
+typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target);
+#endif
+
+#ifndef GL_EXT_convolution
+#define GL_EXT_convolution 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum, GLenum, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei);
+GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *);
+GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
+typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
+typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
+#endif
+
+#ifndef GL_EXT_color_matrix
+#define GL_EXT_color_matrix 1
+#endif
+
+#ifndef GL_SGI_color_table
+#define GL_SGI_color_table 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glColorTableSGI (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glColorTableParameterivSGI (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glCopyColorTableSGI (GLenum, GLenum, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glGetColorTableSGI (GLenum, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum, GLenum, GLint *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
+typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params);
+#endif
+
+#ifndef GL_SGIX_pixel_texture
+#define GL_SGIX_pixel_texture 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPixelTexGenSGIX (GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPIXELTEXGENSGIXPROC) (GLenum mode);
+#endif
+
+#ifndef GL_SGIS_pixel_texture
+#define GL_SGIS_pixel_texture 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPixelTexGenParameteriSGIS (GLenum, GLint);
+GLAPI void APIENTRY glPixelTexGenParameterivSGIS (GLenum, const GLint *);
+GLAPI void APIENTRY glPixelTexGenParameterfSGIS (GLenum, GLfloat);
+GLAPI void APIENTRY glPixelTexGenParameterfvSGIS (GLenum, const GLfloat *);
+GLAPI void APIENTRY glGetPixelTexGenParameterivSGIS (GLenum, GLint *);
+GLAPI void APIENTRY glGetPixelTexGenParameterfvSGIS (GLenum, GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERISGISPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFSGISPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, GLfloat *params);
+#endif
+
+#ifndef GL_SGIS_texture4D
+#define GL_SGIS_texture4D 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glTexImage4DSGIS (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels);
+#endif
+
+#ifndef GL_SGI_texture_color_table
+#define GL_SGI_texture_color_table 1
+#endif
+
+#ifndef GL_EXT_cmyka
+#define GL_EXT_cmyka 1
+#endif
+
+#ifndef GL_EXT_texture_object
+#define GL_EXT_texture_object 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI GLboolean APIENTRY glAreTexturesResidentEXT (GLsizei, const GLuint *, GLboolean *);
+GLAPI void APIENTRY glBindTextureEXT (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteTexturesEXT (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenTexturesEXT (GLsizei, GLuint *);
+GLAPI GLboolean APIENTRY glIsTextureEXT (GLuint);
+GLAPI void APIENTRY glPrioritizeTexturesEXT (GLsizei, const GLuint *, const GLclampf *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef GLboolean (APIENTRYP PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences);
+typedef void (APIENTRYP PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture);
+typedef void (APIENTRYP PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures);
+typedef void (APIENTRYP PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures);
+typedef GLboolean (APIENTRYP PFNGLISTEXTUREEXTPROC) (GLuint texture);
+typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities);
+#endif
+
+#ifndef GL_SGIS_detail_texture
+#define GL_SGIS_detail_texture 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDetailTexFuncSGIS (GLenum, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glGetDetailTexFuncSGIS (GLenum, GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points);
+typedef void (APIENTRYP PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points);
+#endif
+
+#ifndef GL_SGIS_sharpen_texture
+#define GL_SGIS_sharpen_texture 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glSharpenTexFuncSGIS (GLenum, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum, GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points);
+typedef void (APIENTRYP PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points);
+#endif
+
+#ifndef GL_EXT_packed_pixels
+#define GL_EXT_packed_pixels 1
+#endif
+
+#ifndef GL_SGIS_texture_lod
+#define GL_SGIS_texture_lod 1
+#endif
+
+#ifndef GL_SGIS_multisample
+#define GL_SGIS_multisample 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glSampleMaskSGIS (GLclampf, GLboolean);
+GLAPI void APIENTRY glSamplePatternSGIS (GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert);
+typedef void (APIENTRYP PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern);
+#endif
+
+#ifndef GL_EXT_rescale_normal
+#define GL_EXT_rescale_normal 1
+#endif
+
+#ifndef GL_EXT_vertex_array
+#define GL_EXT_vertex_array 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glArrayElementEXT (GLint);
+GLAPI void APIENTRY glColorPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glDrawArraysEXT (GLenum, GLint, GLsizei);
+GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei, GLsizei, const GLboolean *);
+GLAPI void APIENTRY glGetPointervEXT (GLenum, GLvoid* *);
+GLAPI void APIENTRY glIndexPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glNormalPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glTexCoordPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glVertexPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i);
+typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count);
+typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer);
+typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid* *params);
+typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
+#endif
+
+#ifndef GL_EXT_misc_attribute
+#define GL_EXT_misc_attribute 1
+#endif
+
+#ifndef GL_SGIS_generate_mipmap
+#define GL_SGIS_generate_mipmap 1
+#endif
+
+#ifndef GL_SGIX_clipmap
+#define GL_SGIX_clipmap 1
+#endif
+
+#ifndef GL_SGIX_shadow
+#define GL_SGIX_shadow 1
+#endif
+
+#ifndef GL_SGIS_texture_edge_clamp
+#define GL_SGIS_texture_edge_clamp 1
+#endif
+
+#ifndef GL_SGIS_texture_border_clamp
+#define GL_SGIS_texture_border_clamp 1
+#endif
+
+#ifndef GL_EXT_blend_minmax
+#define GL_EXT_blend_minmax 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBlendEquationEXT (GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBLENDEQUATIONEXTPROC) (GLenum mode);
+#endif
+
+#ifndef GL_EXT_blend_subtract
+#define GL_EXT_blend_subtract 1
+#endif
+
+#ifndef GL_EXT_blend_logic_op
+#define GL_EXT_blend_logic_op 1
+#endif
+
+#ifndef GL_SGIX_interlace
+#define GL_SGIX_interlace 1
+#endif
+
+#ifndef GL_SGIX_pixel_tiles
+#define GL_SGIX_pixel_tiles 1
+#endif
+
+#ifndef GL_SGIX_texture_select
+#define GL_SGIX_texture_select 1
+#endif
+
+#ifndef GL_SGIX_sprite
+#define GL_SGIX_sprite 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glSpriteParameterfSGIX (GLenum, GLfloat);
+GLAPI void APIENTRY glSpriteParameterfvSGIX (GLenum, const GLfloat *);
+GLAPI void APIENTRY glSpriteParameteriSGIX (GLenum, GLint);
+GLAPI void APIENTRY glSpriteParameterivSGIX (GLenum, const GLint *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params);
+#endif
+
+#ifndef GL_SGIX_texture_multi_buffer
+#define GL_SGIX_texture_multi_buffer 1
+#endif
+
+#ifndef GL_EXT_point_parameters
+#define GL_EXT_point_parameters 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPointParameterfEXT (GLenum, GLfloat);
+GLAPI void APIENTRY glPointParameterfvEXT (GLenum, const GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params);
+#endif
+
+#ifndef GL_SGIS_point_parameters
+#define GL_SGIS_point_parameters 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPointParameterfSGIS (GLenum, GLfloat);
+GLAPI void APIENTRY glPointParameterfvSGIS (GLenum, const GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params);
+#endif
+
+#ifndef GL_SGIX_instruments
+#define GL_SGIX_instruments 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI GLint APIENTRY glGetInstrumentsSGIX (void);
+GLAPI void APIENTRY glInstrumentsBufferSGIX (GLsizei, GLint *);
+GLAPI GLint APIENTRY glPollInstrumentsSGIX (GLint *);
+GLAPI void APIENTRY glReadInstrumentsSGIX (GLint);
+GLAPI void APIENTRY glStartInstrumentsSGIX (void);
+GLAPI void APIENTRY glStopInstrumentsSGIX (GLint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef GLint (APIENTRYP PFNGLGETINSTRUMENTSSGIXPROC) (void);
+typedef void (APIENTRYP PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer);
+typedef GLint (APIENTRYP PFNGLPOLLINSTRUMENTSSGIXPROC) (GLint *marker_p);
+typedef void (APIENTRYP PFNGLREADINSTRUMENTSSGIXPROC) (GLint marker);
+typedef void (APIENTRYP PFNGLSTARTINSTRUMENTSSGIXPROC) (void);
+typedef void (APIENTRYP PFNGLSTOPINSTRUMENTSSGIXPROC) (GLint marker);
+#endif
+
+#ifndef GL_SGIX_texture_scale_bias
+#define GL_SGIX_texture_scale_bias 1
+#endif
+
+#ifndef GL_SGIX_framezoom
+#define GL_SGIX_framezoom 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glFrameZoomSGIX (GLint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLFRAMEZOOMSGIXPROC) (GLint factor);
+#endif
+
+#ifndef GL_SGIX_tag_sample_buffer
+#define GL_SGIX_tag_sample_buffer 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glTagSampleBufferSGIX (void);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLTAGSAMPLEBUFFERSGIXPROC) (void);
+#endif
+
+#ifndef GL_SGIX_polynomial_ffd
+#define GL_SGIX_polynomial_ffd 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDeformationMap3dSGIX (GLenum, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, const GLdouble *);
+GLAPI void APIENTRY glDeformationMap3fSGIX (GLenum, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, const GLfloat *);
+GLAPI void APIENTRY glDeformSGIX (GLbitfield);
+GLAPI void APIENTRY glLoadIdentityDeformationMapSGIX (GLbitfield);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points);
+typedef void (APIENTRYP PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points);
+typedef void (APIENTRYP PFNGLDEFORMSGIXPROC) (GLbitfield mask);
+typedef void (APIENTRYP PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask);
+#endif
+
+#ifndef GL_SGIX_reference_plane
+#define GL_SGIX_reference_plane 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation);
+#endif
+
+#ifndef GL_SGIX_flush_raster
+#define GL_SGIX_flush_raster 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glFlushRasterSGIX (void);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLFLUSHRASTERSGIXPROC) (void);
+#endif
+
+#ifndef GL_SGIX_depth_texture
+#define GL_SGIX_depth_texture 1
+#endif
+
+#ifndef GL_SGIS_fog_function
+#define GL_SGIS_fog_function 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glFogFuncSGIS (GLsizei, const GLfloat *);
+GLAPI void APIENTRY glGetFogFuncSGIS (GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points);
+typedef void (APIENTRYP PFNGLGETFOGFUNCSGISPROC) (GLfloat *points);
+#endif
+
+#ifndef GL_SGIX_fog_offset
+#define GL_SGIX_fog_offset 1
+#endif
+
+#ifndef GL_HP_image_transform
+#define GL_HP_image_transform 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glImageTransformParameteriHP (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glImageTransformParameterfHP (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glImageTransformParameterivHP (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glImageTransformParameterfvHP (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glGetImageTransformParameterivHP (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum, GLenum, GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params);
+#endif
+
+#ifndef GL_HP_convolution_border_modes
+#define GL_HP_convolution_border_modes 1
+#endif
+
+#ifndef GL_SGIX_texture_add_env
+#define GL_SGIX_texture_add_env 1
+#endif
+
+#ifndef GL_EXT_color_subtable
+#define GL_EXT_color_subtable 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glColorSubTableEXT (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum, GLsizei, GLint, GLint, GLsizei);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+#endif
+
+#ifndef GL_PGI_vertex_hints
+#define GL_PGI_vertex_hints 1
+#endif
+
+#ifndef GL_PGI_misc_hints
+#define GL_PGI_misc_hints 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glHintPGI (GLenum, GLint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLHINTPGIPROC) (GLenum target, GLint mode);
+#endif
+
+#ifndef GL_EXT_paletted_texture
+#define GL_EXT_paletted_texture 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glColorTableEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glGetColorTableEXT (GLenum, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum, GLenum, GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
+#endif
+
+#ifndef GL_EXT_clip_volume_hint
+#define GL_EXT_clip_volume_hint 1
+#endif
+
+#ifndef GL_SGIX_list_priority
+#define GL_SGIX_list_priority 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glGetListParameterfvSGIX (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetListParameterivSGIX (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glListParameterfSGIX (GLuint, GLenum, GLfloat);
+GLAPI void APIENTRY glListParameterfvSGIX (GLuint, GLenum, const GLfloat *);
+GLAPI void APIENTRY glListParameteriSGIX (GLuint, GLenum, GLint);
+GLAPI void APIENTRY glListParameterivSGIX (GLuint, GLenum, const GLint *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params);
+#endif
+
+#ifndef GL_SGIX_ir_instrument1
+#define GL_SGIX_ir_instrument1 1
+#endif
+
+#ifndef GL_SGIX_calligraphic_fragment
+#define GL_SGIX_calligraphic_fragment 1
+#endif
+
+#ifndef GL_SGIX_texture_lod_bias
+#define GL_SGIX_texture_lod_bias 1
+#endif
+
+#ifndef GL_SGIX_shadow_ambient
+#define GL_SGIX_shadow_ambient 1
+#endif
+
+#ifndef GL_EXT_index_texture
+#define GL_EXT_index_texture 1
+#endif
+
+#ifndef GL_EXT_index_material
+#define GL_EXT_index_material 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glIndexMaterialEXT (GLenum, GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode);
+#endif
+
+#ifndef GL_EXT_index_func
+#define GL_EXT_index_func 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glIndexFuncEXT (GLenum, GLclampf);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref);
+#endif
+
+#ifndef GL_EXT_index_array_formats
+#define GL_EXT_index_array_formats 1
+#endif
+
+#ifndef GL_EXT_compiled_vertex_array
+#define GL_EXT_compiled_vertex_array 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glLockArraysEXT (GLint, GLsizei);
+GLAPI void APIENTRY glUnlockArraysEXT (void);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count);
+typedef void (APIENTRYP PFNGLUNLOCKARRAYSEXTPROC) (void);
+#endif
+
+#ifndef GL_EXT_cull_vertex
+#define GL_EXT_cull_vertex 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glCullParameterdvEXT (GLenum, GLdouble *);
+GLAPI void APIENTRY glCullParameterfvEXT (GLenum, GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params);
+typedef void (APIENTRYP PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params);
+#endif
+
+#ifndef GL_SGIX_ycrcb
+#define GL_SGIX_ycrcb 1
+#endif
+
+#ifndef GL_SGIX_fragment_lighting
+#define GL_SGIX_fragment_lighting 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glFragmentColorMaterialSGIX (GLenum, GLenum);
+GLAPI void APIENTRY glFragmentLightfSGIX (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glFragmentLightfvSGIX (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glFragmentLightiSGIX (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glFragmentLightivSGIX (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glFragmentLightModelfSGIX (GLenum, GLfloat);
+GLAPI void APIENTRY glFragmentLightModelfvSGIX (GLenum, const GLfloat *);
+GLAPI void APIENTRY glFragmentLightModeliSGIX (GLenum, GLint);
+GLAPI void APIENTRY glFragmentLightModelivSGIX (GLenum, const GLint *);
+GLAPI void APIENTRY glFragmentMaterialfSGIX (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glFragmentMaterialfvSGIX (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glFragmentMaterialiSGIX (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glFragmentMaterialivSGIX (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glGetFragmentLightfvSGIX (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetFragmentLightivSGIX (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetFragmentMaterialfvSGIX (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetFragmentMaterialivSGIX (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glLightEnviSGIX (GLenum, GLint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param);
+#endif
+
+#ifndef GL_IBM_rasterpos_clip
+#define GL_IBM_rasterpos_clip 1
+#endif
+
+#ifndef GL_HP_texture_lighting
+#define GL_HP_texture_lighting 1
+#endif
+
+#ifndef GL_EXT_draw_range_elements
+#define GL_EXT_draw_range_elements 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
+#endif
+
+#ifndef GL_WIN_phong_shading
+#define GL_WIN_phong_shading 1
+#endif
+
+#ifndef GL_WIN_specular_fog
+#define GL_WIN_specular_fog 1
+#endif
+
+#ifndef GL_EXT_light_texture
+#define GL_EXT_light_texture 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glApplyTextureEXT (GLenum);
+GLAPI void APIENTRY glTextureLightEXT (GLenum);
+GLAPI void APIENTRY glTextureMaterialEXT (GLenum, GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode);
+typedef void (APIENTRYP PFNGLTEXTURELIGHTEXTPROC) (GLenum pname);
+typedef void (APIENTRYP PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode);
+#endif
+
+#ifndef GL_SGIX_blend_alpha_minmax
+#define GL_SGIX_blend_alpha_minmax 1
+#endif
+
+#ifndef GL_EXT_bgra
+#define GL_EXT_bgra 1
+#endif
+
+#ifndef GL_SGIX_async
+#define GL_SGIX_async 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glAsyncMarkerSGIX (GLuint);
+GLAPI GLint APIENTRY glFinishAsyncSGIX (GLuint *);
+GLAPI GLint APIENTRY glPollAsyncSGIX (GLuint *);
+GLAPI GLuint APIENTRY glGenAsyncMarkersSGIX (GLsizei);
+GLAPI void APIENTRY glDeleteAsyncMarkersSGIX (GLuint, GLsizei);
+GLAPI GLboolean APIENTRY glIsAsyncMarkerSGIX (GLuint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLASYNCMARKERSGIXPROC) (GLuint marker);
+typedef GLint (APIENTRYP PFNGLFINISHASYNCSGIXPROC) (GLuint *markerp);
+typedef GLint (APIENTRYP PFNGLPOLLASYNCSGIXPROC) (GLuint *markerp);
+typedef GLuint (APIENTRYP PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range);
+typedef void (APIENTRYP PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range);
+typedef GLboolean (APIENTRYP PFNGLISASYNCMARKERSGIXPROC) (GLuint marker);
+#endif
+
+#ifndef GL_SGIX_async_pixel
+#define GL_SGIX_async_pixel 1
+#endif
+
+#ifndef GL_SGIX_async_histogram
+#define GL_SGIX_async_histogram 1
+#endif
+
+#ifndef GL_INTEL_parallel_arrays
+#define GL_INTEL_parallel_arrays 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glVertexPointervINTEL (GLint, GLenum, const GLvoid* *);
+GLAPI void APIENTRY glNormalPointervINTEL (GLenum, const GLvoid* *);
+GLAPI void APIENTRY glColorPointervINTEL (GLint, GLenum, const GLvoid* *);
+GLAPI void APIENTRY glTexCoordPointervINTEL (GLint, GLenum, const GLvoid* *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
+typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid* *pointer);
+typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
+typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
+#endif
+
+#ifndef GL_HP_occlusion_test
+#define GL_HP_occlusion_test 1
+#endif
+
+#ifndef GL_EXT_pixel_transform
+#define GL_EXT_pixel_transform 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPixelTransformParameteriEXT (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glPixelTransformParameterfEXT (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glPixelTransformParameterivEXT (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glPixelTransformParameterfvEXT (GLenum, GLenum, const GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params);
+#endif
+
+#ifndef GL_EXT_pixel_transform_color_table
+#define GL_EXT_pixel_transform_color_table 1
+#endif
+
+#ifndef GL_EXT_shared_texture_palette
+#define GL_EXT_shared_texture_palette 1
+#endif
+
+#ifndef GL_EXT_separate_specular_color
+#define GL_EXT_separate_specular_color 1
+#endif
+
+#ifndef GL_EXT_secondary_color
+#define GL_EXT_secondary_color 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte, GLbyte, GLbyte);
+GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *);
+GLAPI void APIENTRY glSecondaryColor3dEXT (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glSecondaryColor3dvEXT (const GLdouble *);
+GLAPI void APIENTRY glSecondaryColor3fEXT (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glSecondaryColor3fvEXT (const GLfloat *);
+GLAPI void APIENTRY glSecondaryColor3iEXT (GLint, GLint, GLint);
+GLAPI void APIENTRY glSecondaryColor3ivEXT (const GLint *);
+GLAPI void APIENTRY glSecondaryColor3sEXT (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glSecondaryColor3svEXT (const GLshort *);
+GLAPI void APIENTRY glSecondaryColor3ubEXT (GLubyte, GLubyte, GLubyte);
+GLAPI void APIENTRY glSecondaryColor3ubvEXT (const GLubyte *);
+GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *);
+GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort, GLushort, GLushort);
+GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *);
+GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint, GLenum, GLsizei, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+#endif
+
+#ifndef GL_EXT_texture_perturb_normal
+#define GL_EXT_texture_perturb_normal 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glTextureNormalEXT (GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLTEXTURENORMALEXTPROC) (GLenum mode);
+#endif
+
+#ifndef GL_EXT_multi_draw_arrays
+#define GL_EXT_multi_draw_arrays 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum, GLint *, GLsizei *, GLsizei);
+GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount);
+typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount);
+#endif
+
+#ifndef GL_EXT_fog_coord
+#define GL_EXT_fog_coord 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glFogCoordfEXT (GLfloat);
+GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *);
+GLAPI void APIENTRY glFogCoorddEXT (GLdouble);
+GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *);
+GLAPI void APIENTRY glFogCoordPointerEXT (GLenum, GLsizei, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord);
+typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord);
+typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord);
+typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord);
+typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
+#endif
+
+#ifndef GL_REND_screen_coordinates
+#define GL_REND_screen_coordinates 1
+#endif
+
+#ifndef GL_EXT_coordinate_frame
+#define GL_EXT_coordinate_frame 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glTangent3bEXT (GLbyte, GLbyte, GLbyte);
+GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *);
+GLAPI void APIENTRY glTangent3dEXT (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glTangent3dvEXT (const GLdouble *);
+GLAPI void APIENTRY glTangent3fEXT (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTangent3fvEXT (const GLfloat *);
+GLAPI void APIENTRY glTangent3iEXT (GLint, GLint, GLint);
+GLAPI void APIENTRY glTangent3ivEXT (const GLint *);
+GLAPI void APIENTRY glTangent3sEXT (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glTangent3svEXT (const GLshort *);
+GLAPI void APIENTRY glBinormal3bEXT (GLbyte, GLbyte, GLbyte);
+GLAPI void APIENTRY glBinormal3bvEXT (const GLbyte *);
+GLAPI void APIENTRY glBinormal3dEXT (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glBinormal3dvEXT (const GLdouble *);
+GLAPI void APIENTRY glBinormal3fEXT (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glBinormal3fvEXT (const GLfloat *);
+GLAPI void APIENTRY glBinormal3iEXT (GLint, GLint, GLint);
+GLAPI void APIENTRY glBinormal3ivEXT (const GLint *);
+GLAPI void APIENTRY glBinormal3sEXT (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glBinormal3svEXT (const GLshort *);
+GLAPI void APIENTRY glTangentPointerEXT (GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glBinormalPointerEXT (GLenum, GLsizei, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz);
+typedef void (APIENTRYP PFNGLTANGENT3BVEXTPROC) (const GLbyte *v);
+typedef void (APIENTRYP PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz);
+typedef void (APIENTRYP PFNGLTANGENT3DVEXTPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz);
+typedef void (APIENTRYP PFNGLTANGENT3FVEXTPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz);
+typedef void (APIENTRYP PFNGLTANGENT3IVEXTPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz);
+typedef void (APIENTRYP PFNGLTANGENT3SVEXTPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz);
+typedef void (APIENTRYP PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v);
+typedef void (APIENTRYP PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz);
+typedef void (APIENTRYP PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz);
+typedef void (APIENTRYP PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz);
+typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz);
+typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
+#endif
+
+#ifndef GL_EXT_texture_env_combine
+#define GL_EXT_texture_env_combine 1
+#endif
+
+#ifndef GL_APPLE_specular_vector
+#define GL_APPLE_specular_vector 1
+#endif
+
+#ifndef GL_APPLE_transform_hint
+#define GL_APPLE_transform_hint 1
+#endif
+
+#ifndef GL_SGIX_fog_scale
+#define GL_SGIX_fog_scale 1
+#endif
+
+#ifndef GL_SUNX_constant_data
+#define GL_SUNX_constant_data 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glFinishTextureSUNX (void);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLFINISHTEXTURESUNXPROC) (void);
+#endif
+
+#ifndef GL_SUN_global_alpha
+#define GL_SUN_global_alpha 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glGlobalAlphaFactorbSUN (GLbyte);
+GLAPI void APIENTRY glGlobalAlphaFactorsSUN (GLshort);
+GLAPI void APIENTRY glGlobalAlphaFactoriSUN (GLint);
+GLAPI void APIENTRY glGlobalAlphaFactorfSUN (GLfloat);
+GLAPI void APIENTRY glGlobalAlphaFactordSUN (GLdouble);
+GLAPI void APIENTRY glGlobalAlphaFactorubSUN (GLubyte);
+GLAPI void APIENTRY glGlobalAlphaFactorusSUN (GLushort);
+GLAPI void APIENTRY glGlobalAlphaFactoruiSUN (GLuint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORBSUNPROC) (GLbyte factor);
+typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORSSUNPROC) (GLshort factor);
+typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORISUNPROC) (GLint factor);
+typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORFSUNPROC) (GLfloat factor);
+typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORDSUNPROC) (GLdouble factor);
+typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUBSUNPROC) (GLubyte factor);
+typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUSSUNPROC) (GLushort factor);
+typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUISUNPROC) (GLuint factor);
+#endif
+
+#ifndef GL_SUN_triangle_list
+#define GL_SUN_triangle_list 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint);
+GLAPI void APIENTRY glReplacementCodeusSUN (GLushort);
+GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte);
+GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *);
+GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *);
+GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *);
+GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum, GLsizei, const GLvoid* *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUISUNPROC) (GLuint code);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSSUNPROC) (GLushort code);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid* *pointer);
+#endif
+
+#ifndef GL_SUN_vertex
+#define GL_SUN_vertex 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glColor4ubVertex2fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat);
+GLAPI void APIENTRY glColor4ubVertex2fvSUN (const GLubyte *, const GLfloat *);
+GLAPI void APIENTRY glColor4ubVertex3fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glColor4ubVertex3fvSUN (const GLubyte *, const GLfloat *);
+GLAPI void APIENTRY glColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glColor3fVertex3fvSUN (const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord2fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord2fVertex3fvSUN (const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord4fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord4fVertex4fvSUN (const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fSUN (GLfloat, GLfloat, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *, const GLubyte *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord2fColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord2fColor3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiVertex3fvSUN (const GLuint *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fSUN (GLuint, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *, const GLubyte *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
+#endif
+
+#ifndef GL_EXT_blend_func_separate
+#define GL_EXT_blend_func_separate 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBlendFuncSeparateEXT (GLenum, GLenum, GLenum, GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+#endif
+
+#ifndef GL_INGR_blend_func_separate
+#define GL_INGR_blend_func_separate 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum, GLenum, GLenum, GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+#endif
+
+#ifndef GL_INGR_color_clamp
+#define GL_INGR_color_clamp 1
+#endif
+
+#ifndef GL_INGR_interlace_read
+#define GL_INGR_interlace_read 1
+#endif
+
+#ifndef GL_EXT_stencil_wrap
+#define GL_EXT_stencil_wrap 1
+#endif
+
+#ifndef GL_EXT_422_pixels
+#define GL_EXT_422_pixels 1
+#endif
+
+#ifndef GL_NV_texgen_reflection
+#define GL_NV_texgen_reflection 1
+#endif
+
+#ifndef GL_SUN_convolution_border_modes
+#define GL_SUN_convolution_border_modes 1
+#endif
+
+#ifndef GL_EXT_texture_env_add
+#define GL_EXT_texture_env_add 1
+#endif
+
+#ifndef GL_EXT_texture_lod_bias
+#define GL_EXT_texture_lod_bias 1
+#endif
+
+#ifndef GL_EXT_texture_filter_anisotropic
+#define GL_EXT_texture_filter_anisotropic 1
+#endif
+
+#ifndef GL_EXT_vertex_weighting
+#define GL_EXT_vertex_weighting 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glVertexWeightfEXT (GLfloat);
+GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *);
+GLAPI void APIENTRY glVertexWeightPointerEXT (GLsizei, GLenum, GLsizei, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight);
+typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight);
+typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer);
+#endif
+
+#ifndef GL_NV_light_max_exponent
+#define GL_NV_light_max_exponent 1
+#endif
+
+#ifndef GL_NV_vertex_array_range
+#define GL_NV_vertex_array_range 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glFlushVertexArrayRangeNV (void);
+GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void);
+typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer);
+#endif
+
+#ifndef GL_NV_register_combiners
+#define GL_NV_register_combiners 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glCombinerParameterfvNV (GLenum, const GLfloat *);
+GLAPI void APIENTRY glCombinerParameterfNV (GLenum, GLfloat);
+GLAPI void APIENTRY glCombinerParameterivNV (GLenum, const GLint *);
+GLAPI void APIENTRY glCombinerParameteriNV (GLenum, GLint);
+GLAPI void APIENTRY glCombinerInputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glCombinerOutputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLboolean, GLboolean, GLboolean);
+GLAPI void APIENTRY glFinalCombinerInputNV (GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glGetCombinerInputParameterfvNV (GLenum, GLenum, GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetCombinerInputParameterivNV (GLenum, GLenum, GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetCombinerOutputParameterfvNV (GLenum, GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetCombinerOutputParameterivNV (GLenum, GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetFinalCombinerInputParameterfvNV (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetFinalCombinerInputParameterivNV (GLenum, GLenum, GLint *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
+typedef void (APIENTRYP PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum);
+typedef void (APIENTRYP PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
+typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params);
+#endif
+
+#ifndef GL_NV_fog_distance
+#define GL_NV_fog_distance 1
+#endif
+
+#ifndef GL_NV_texgen_emboss
+#define GL_NV_texgen_emboss 1
+#endif
+
+#ifndef GL_NV_blend_square
+#define GL_NV_blend_square 1
+#endif
+
+#ifndef GL_NV_texture_env_combine4
+#define GL_NV_texture_env_combine4 1
+#endif
+
+#ifndef GL_MESA_resize_buffers
+#define GL_MESA_resize_buffers 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glResizeBuffersMESA (void);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void);
+#endif
+
+#ifndef GL_MESA_window_pos
+#define GL_MESA_window_pos 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glWindowPos2dMESA (GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos2dvMESA (const GLdouble *);
+GLAPI void APIENTRY glWindowPos2fMESA (GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos2fvMESA (const GLfloat *);
+GLAPI void APIENTRY glWindowPos2iMESA (GLint, GLint);
+GLAPI void APIENTRY glWindowPos2ivMESA (const GLint *);
+GLAPI void APIENTRY glWindowPos2sMESA (GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos2svMESA (const GLshort *);
+GLAPI void APIENTRY glWindowPos3dMESA (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos3dvMESA (const GLdouble *);
+GLAPI void APIENTRY glWindowPos3fMESA (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos3fvMESA (const GLfloat *);
+GLAPI void APIENTRY glWindowPos3iMESA (GLint, GLint, GLint);
+GLAPI void APIENTRY glWindowPos3ivMESA (const GLint *);
+GLAPI void APIENTRY glWindowPos3sMESA (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos3svMESA (const GLshort *);
+GLAPI void APIENTRY glWindowPos4dMESA (GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos4dvMESA (const GLdouble *);
+GLAPI void APIENTRY glWindowPos4fMESA (GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos4fvMESA (const GLfloat *);
+GLAPI void APIENTRY glWindowPos4iMESA (GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glWindowPos4ivMESA (const GLint *);
+GLAPI void APIENTRY glWindowPos4sMESA (GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2IVMESAPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IVMESAPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w);
+typedef void (APIENTRYP PFNGLWINDOWPOS4IVMESAPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (APIENTRYP PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v);
+#endif
+
+#ifndef GL_IBM_cull_vertex
+#define GL_IBM_cull_vertex 1
+#endif
+
+#ifndef GL_IBM_multimode_draw_arrays
+#define GL_IBM_multimode_draw_arrays 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *, const GLint *, const GLsizei *, GLsizei, GLint);
+GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *, const GLsizei *, GLenum, const GLvoid* const *, GLsizei, GLint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride);
+typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride);
+#endif
+
+#ifndef GL_IBM_vertex_array_lists
+#define GL_IBM_vertex_array_lists 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint, const GLboolean* *, GLint);
+GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glIndexPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glNormalPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glTexCoordPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glVertexPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+#endif
+
+#ifndef GL_SGIX_subsample
+#define GL_SGIX_subsample 1
+#endif
+
+#ifndef GL_SGIX_ycrcba
+#define GL_SGIX_ycrcba 1
+#endif
+
+#ifndef GL_SGIX_ycrcb_subsample
+#define GL_SGIX_ycrcb_subsample 1
+#endif
+
+#ifndef GL_SGIX_depth_pass_instrument
+#define GL_SGIX_depth_pass_instrument 1
+#endif
+
+#ifndef GL_3DFX_texture_compression_FXT1
+#define GL_3DFX_texture_compression_FXT1 1
+#endif
+
+#ifndef GL_3DFX_multisample
+#define GL_3DFX_multisample 1
+#endif
+
+#ifndef GL_3DFX_tbuffer
+#define GL_3DFX_tbuffer 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glTbufferMask3DFX (GLuint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLTBUFFERMASK3DFXPROC) (GLuint mask);
+#endif
+
+#ifndef GL_EXT_multisample
+#define GL_EXT_multisample 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glSampleMaskEXT (GLclampf, GLboolean);
+GLAPI void APIENTRY glSamplePatternEXT (GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert);
+typedef void (APIENTRYP PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern);
+#endif
+
+#ifndef GL_SGIX_vertex_preclip
+#define GL_SGIX_vertex_preclip 1
+#endif
+
+#ifndef GL_SGIX_convolution_accuracy
+#define GL_SGIX_convolution_accuracy 1
+#endif
+
+#ifndef GL_SGIX_resample
+#define GL_SGIX_resample 1
+#endif
+
+#ifndef GL_SGIS_point_line_texgen
+#define GL_SGIS_point_line_texgen 1
+#endif
+
+#ifndef GL_SGIS_texture_color_mask
+#define GL_SGIS_texture_color_mask 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glTextureColorMaskSGIS (GLboolean, GLboolean, GLboolean, GLboolean);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha);
+#endif
+
+#ifndef GL_SGIX_igloo_interface
+#define GL_SGIX_igloo_interface 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params);
+#endif
+
+#ifndef GL_EXT_texture_env_dot3
+#define GL_EXT_texture_env_dot3 1
+#endif
+
+#ifndef GL_ATI_texture_mirror_once
+#define GL_ATI_texture_mirror_once 1
+#endif
+
+#ifndef GL_NV_fence
+#define GL_NV_fence 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDeleteFencesNV (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenFencesNV (GLsizei, GLuint *);
+GLAPI GLboolean APIENTRY glIsFenceNV (GLuint);
+GLAPI GLboolean APIENTRY glTestFenceNV (GLuint);
+GLAPI void APIENTRY glGetFenceivNV (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glFinishFenceNV (GLuint);
+GLAPI void APIENTRY glSetFenceNV (GLuint, GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences);
+typedef void (APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences);
+typedef GLboolean (APIENTRYP PFNGLISFENCENVPROC) (GLuint fence);
+typedef GLboolean (APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence);
+typedef void (APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence);
+typedef void (APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition);
+#endif
+
+#ifndef GL_NV_evaluators
+#define GL_NV_evaluators 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLint, GLint, GLboolean, const GLvoid *);
+GLAPI void APIENTRY glMapParameterivNV (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glMapParameterfvNV (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glGetMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLboolean, GLvoid *);
+GLAPI void APIENTRY glGetMapParameterivNV (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetMapParameterfvNV (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum, GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetMapAttribParameterfvNV (GLenum, GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glEvalMapsNV (GLenum, GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points);
+typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points);
+typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode);
+#endif
+
+#ifndef GL_NV_packed_depth_stencil
+#define GL_NV_packed_depth_stencil 1
+#endif
+
+#ifndef GL_NV_register_combiners2
+#define GL_NV_register_combiners2 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glCombinerStageParameterfvNV (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum, GLenum, GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params);
+#endif
+
+#ifndef GL_NV_texture_compression_vtc
+#define GL_NV_texture_compression_vtc 1
+#endif
+
+#ifndef GL_NV_texture_rectangle
+#define GL_NV_texture_rectangle 1
+#endif
+
+#ifndef GL_NV_texture_shader
+#define GL_NV_texture_shader 1
+#endif
+
+#ifndef GL_NV_texture_shader2
+#define GL_NV_texture_shader2 1
+#endif
+
+#ifndef GL_NV_vertex_array_range2
+#define GL_NV_vertex_array_range2 1
+#endif
+
+#ifndef GL_NV_vertex_program
+#define GL_NV_vertex_program 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI GLboolean APIENTRY glAreProgramsResidentNV (GLsizei, const GLuint *, GLboolean *);
+GLAPI void APIENTRY glBindProgramNV (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteProgramsNV (GLsizei, const GLuint *);
+GLAPI void APIENTRY glExecuteProgramNV (GLenum, GLuint, const GLfloat *);
+GLAPI void APIENTRY glGenProgramsNV (GLsizei, GLuint *);
+GLAPI void APIENTRY glGetProgramParameterdvNV (GLenum, GLuint, GLenum, GLdouble *);
+GLAPI void APIENTRY glGetProgramParameterfvNV (GLenum, GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetProgramivNV (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetProgramStringNV (GLuint, GLenum, GLubyte *);
+GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum, GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint, GLenum, GLdouble *);
+GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVertexAttribivNV (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint, GLenum, GLvoid* *);
+GLAPI GLboolean APIENTRY glIsProgramNV (GLuint);
+GLAPI void APIENTRY glLoadProgramNV (GLenum, GLuint, GLsizei, const GLubyte *);
+GLAPI void APIENTRY glProgramParameter4dNV (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glProgramParameter4dvNV (GLenum, GLuint, const GLdouble *);
+GLAPI void APIENTRY glProgramParameter4fNV (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glProgramParameter4fvNV (GLenum, GLuint, const GLfloat *);
+GLAPI void APIENTRY glProgramParameters4dvNV (GLenum, GLuint, GLuint, const GLdouble *);
+GLAPI void APIENTRY glProgramParameters4fvNV (GLenum, GLuint, GLuint, const GLfloat *);
+GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei, const GLuint *);
+GLAPI void APIENTRY glTrackMatrixNV (GLenum, GLuint, GLenum, GLenum);
+GLAPI void APIENTRY glVertexAttribPointerNV (GLuint, GLint, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glVertexAttrib1dNV (GLuint, GLdouble);
+GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib1fNV (GLuint, GLfloat);
+GLAPI void APIENTRY glVertexAttrib1fvNV (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib1sNV (GLuint, GLshort);
+GLAPI void APIENTRY glVertexAttrib1svNV (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib2dNV (GLuint, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib2dvNV (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib2fNV (GLuint, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib2fvNV (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib2sNV (GLuint, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib2svNV (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib3dNV (GLuint, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib3dvNV (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib3fNV (GLuint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib3fvNV (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib3sNV (GLuint, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib3svNV (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4dNV (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib4dvNV (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib4fNV (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib4fvNV (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib4sNV (GLuint, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib4svNV (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4ubNV (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
+GLAPI void APIENTRY glVertexAttrib4ubvNV (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVertexAttribs1dvNV (GLuint, GLsizei, const GLdouble *);
+GLAPI void APIENTRY glVertexAttribs1fvNV (GLuint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glVertexAttribs1svNV (GLuint, GLsizei, const GLshort *);
+GLAPI void APIENTRY glVertexAttribs2dvNV (GLuint, GLsizei, const GLdouble *);
+GLAPI void APIENTRY glVertexAttribs2fvNV (GLuint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glVertexAttribs2svNV (GLuint, GLsizei, const GLshort *);
+GLAPI void APIENTRY glVertexAttribs3dvNV (GLuint, GLsizei, const GLdouble *);
+GLAPI void APIENTRY glVertexAttribs3fvNV (GLuint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glVertexAttribs3svNV (GLuint, GLsizei, const GLshort *);
+GLAPI void APIENTRY glVertexAttribs4dvNV (GLuint, GLsizei, const GLdouble *);
+GLAPI void APIENTRY glVertexAttribs4fvNV (GLuint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glVertexAttribs4svNV (GLuint, GLsizei, const GLshort *);
+GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint, GLsizei, const GLubyte *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef GLboolean (APIENTRYP PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences);
+typedef void (APIENTRYP PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id);
+typedef void (APIENTRYP PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs);
+typedef void (APIENTRYP PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs);
+typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program);
+typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
+typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id);
+typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs);
+typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v);
+#endif
+
+#ifndef GL_SGIX_texture_coordinate_clamp
+#define GL_SGIX_texture_coordinate_clamp 1
+#endif
+
+#ifndef GL_SGIX_scalebias_hint
+#define GL_SGIX_scalebias_hint 1
+#endif
+
+#ifndef GL_OML_interlace
+#define GL_OML_interlace 1
+#endif
+
+#ifndef GL_OML_subsample
+#define GL_OML_subsample 1
+#endif
+
+#ifndef GL_OML_resample
+#define GL_OML_resample 1
+#endif
+
+#ifndef GL_NV_copy_depth_to_color
+#define GL_NV_copy_depth_to_color 1
+#endif
+
+#ifndef GL_ATI_envmap_bumpmap
+#define GL_ATI_envmap_bumpmap 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glTexBumpParameterivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glTexBumpParameterfvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glGetTexBumpParameterivATI (GLenum, GLint *);
+GLAPI void APIENTRY glGetTexBumpParameterfvATI (GLenum, GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param);
+typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param);
+typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param);
+typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param);
+#endif
+
+#ifndef GL_ATI_fragment_shader
+#define GL_ATI_fragment_shader 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI GLuint APIENTRY glGenFragmentShadersATI (GLuint);
+GLAPI void APIENTRY glBindFragmentShaderATI (GLuint);
+GLAPI void APIENTRY glDeleteFragmentShaderATI (GLuint);
+GLAPI void APIENTRY glBeginFragmentShaderATI (void);
+GLAPI void APIENTRY glEndFragmentShaderATI (void);
+GLAPI void APIENTRY glPassTexCoordATI (GLuint, GLuint, GLenum);
+GLAPI void APIENTRY glSampleMapATI (GLuint, GLuint, GLenum);
+GLAPI void APIENTRY glColorFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glColorFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glColorFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glAlphaFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glAlphaFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glAlphaFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glSetFragmentShaderConstantATI (GLuint, const GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef GLuint (APIENTRYP PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range);
+typedef void (APIENTRYP PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id);
+typedef void (APIENTRYP PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id);
+typedef void (APIENTRYP PFNGLBEGINFRAGMENTSHADERATIPROC) (void);
+typedef void (APIENTRYP PFNGLENDFRAGMENTSHADERATIPROC) (void);
+typedef void (APIENTRYP PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle);
+typedef void (APIENTRYP PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle);
+typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
+typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
+typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
+typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
+typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
+typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
+typedef void (APIENTRYP PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat *value);
+#endif
+
+#ifndef GL_ATI_pn_triangles
+#define GL_ATI_pn_triangles 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPNTrianglesiATI (GLenum, GLint);
+GLAPI void APIENTRY glPNTrianglesfATI (GLenum, GLfloat);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param);
+#endif
+
+#ifndef GL_ATI_vertex_array_object
+#define GL_ATI_vertex_array_object 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei, const GLvoid *, GLenum);
+GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint);
+GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint, GLuint, GLsizei, const GLvoid *, GLenum);
+GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetObjectBufferivATI (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glFreeObjectBufferATI (GLuint);
+GLAPI void APIENTRY glArrayObjectATI (GLenum, GLint, GLenum, GLsizei, GLuint, GLuint);
+GLAPI void APIENTRY glGetArrayObjectfvATI (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetArrayObjectivATI (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glVariantArrayObjectATI (GLuint, GLenum, GLsizei, GLuint, GLuint);
+GLAPI void APIENTRY glGetVariantArrayObjectfvATI (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVariantArrayObjectivATI (GLuint, GLenum, GLint *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage);
+typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer);
+typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve);
+typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer);
+typedef void (APIENTRYP PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
+typedef void (APIENTRYP PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
+typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params);
+#endif
+
+#ifndef GL_EXT_vertex_shader
+#define GL_EXT_vertex_shader 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBeginVertexShaderEXT (void);
+GLAPI void APIENTRY glEndVertexShaderEXT (void);
+GLAPI void APIENTRY glBindVertexShaderEXT (GLuint);
+GLAPI GLuint APIENTRY glGenVertexShadersEXT (GLuint);
+GLAPI void APIENTRY glDeleteVertexShaderEXT (GLuint);
+GLAPI void APIENTRY glShaderOp1EXT (GLenum, GLuint, GLuint);
+GLAPI void APIENTRY glShaderOp2EXT (GLenum, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glShaderOp3EXT (GLenum, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glSwizzleEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glWriteMaskEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glInsertComponentEXT (GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glExtractComponentEXT (GLuint, GLuint, GLuint);
+GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum, GLenum, GLenum, GLuint);
+GLAPI void APIENTRY glSetInvariantEXT (GLuint, GLenum, const GLvoid *);
+GLAPI void APIENTRY glSetLocalConstantEXT (GLuint, GLenum, const GLvoid *);
+GLAPI void APIENTRY glVariantbvEXT (GLuint, const GLbyte *);
+GLAPI void APIENTRY glVariantsvEXT (GLuint, const GLshort *);
+GLAPI void APIENTRY glVariantivEXT (GLuint, const GLint *);
+GLAPI void APIENTRY glVariantfvEXT (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVariantdvEXT (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVariantubvEXT (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVariantusvEXT (GLuint, const GLushort *);
+GLAPI void APIENTRY glVariantuivEXT (GLuint, const GLuint *);
+GLAPI void APIENTRY glVariantPointerEXT (GLuint, GLenum, GLuint, const GLvoid *);
+GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint);
+GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint);
+GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum, GLenum);
+GLAPI GLuint APIENTRY glBindMaterialParameterEXT (GLenum, GLenum);
+GLAPI GLuint APIENTRY glBindTexGenParameterEXT (GLenum, GLenum, GLenum);
+GLAPI GLuint APIENTRY glBindTextureUnitParameterEXT (GLenum, GLenum);
+GLAPI GLuint APIENTRY glBindParameterEXT (GLenum);
+GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint, GLenum);
+GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint, GLenum, GLboolean *);
+GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVariantPointervEXT (GLuint, GLenum, GLvoid* *);
+GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint, GLenum, GLboolean *);
+GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetLocalConstantBooleanvEXT (GLuint, GLenum, GLboolean *);
+GLAPI void APIENTRY glGetLocalConstantIntegervEXT (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint, GLenum, GLfloat *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBEGINVERTEXSHADEREXTPROC) (void);
+typedef void (APIENTRYP PFNGLENDVERTEXSHADEREXTPROC) (void);
+typedef void (APIENTRYP PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id);
+typedef GLuint (APIENTRYP PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range);
+typedef void (APIENTRYP PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id);
+typedef void (APIENTRYP PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1);
+typedef void (APIENTRYP PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2);
+typedef void (APIENTRYP PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3);
+typedef void (APIENTRYP PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW);
+typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW);
+typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num);
+typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num);
+typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components);
+typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr);
+typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr);
+typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr);
+typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr);
+typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr);
+typedef void (APIENTRYP PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr);
+typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr);
+typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr);
+typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr);
+typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr);
+typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr);
+typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id);
+typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id);
+typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value);
+typedef GLuint (APIENTRYP PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value);
+typedef GLuint (APIENTRYP PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value);
+typedef GLuint (APIENTRYP PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value);
+typedef GLuint (APIENTRYP PFNGLBINDPARAMETEREXTPROC) (GLenum value);
+typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap);
+typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
+typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
+typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
+typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid* *data);
+typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
+typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
+typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
+typedef void (APIENTRYP PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
+typedef void (APIENTRYP PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
+typedef void (APIENTRYP PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
+#endif
+
+#ifndef GL_ATI_vertex_streams
+#define GL_ATI_vertex_streams 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glVertexStream1sATI (GLenum, GLshort);
+GLAPI void APIENTRY glVertexStream1svATI (GLenum, const GLshort *);
+GLAPI void APIENTRY glVertexStream1iATI (GLenum, GLint);
+GLAPI void APIENTRY glVertexStream1ivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glVertexStream1fATI (GLenum, GLfloat);
+GLAPI void APIENTRY glVertexStream1fvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glVertexStream1dATI (GLenum, GLdouble);
+GLAPI void APIENTRY glVertexStream1dvATI (GLenum, const GLdouble *);
+GLAPI void APIENTRY glVertexStream2sATI (GLenum, GLshort, GLshort);
+GLAPI void APIENTRY glVertexStream2svATI (GLenum, const GLshort *);
+GLAPI void APIENTRY glVertexStream2iATI (GLenum, GLint, GLint);
+GLAPI void APIENTRY glVertexStream2ivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glVertexStream2fATI (GLenum, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexStream2fvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glVertexStream2dATI (GLenum, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexStream2dvATI (GLenum, const GLdouble *);
+GLAPI void APIENTRY glVertexStream3sATI (GLenum, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexStream3svATI (GLenum, const GLshort *);
+GLAPI void APIENTRY glVertexStream3iATI (GLenum, GLint, GLint, GLint);
+GLAPI void APIENTRY glVertexStream3ivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glVertexStream3fATI (GLenum, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexStream3fvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glVertexStream3dATI (GLenum, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexStream3dvATI (GLenum, const GLdouble *);
+GLAPI void APIENTRY glVertexStream4sATI (GLenum, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexStream4svATI (GLenum, const GLshort *);
+GLAPI void APIENTRY glVertexStream4iATI (GLenum, GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glVertexStream4ivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glVertexStream4fATI (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexStream4fvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glVertexStream4dATI (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexStream4dvATI (GLenum, const GLdouble *);
+GLAPI void APIENTRY glNormalStream3bATI (GLenum, GLbyte, GLbyte, GLbyte);
+GLAPI void APIENTRY glNormalStream3bvATI (GLenum, const GLbyte *);
+GLAPI void APIENTRY glNormalStream3sATI (GLenum, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glNormalStream3svATI (GLenum, const GLshort *);
+GLAPI void APIENTRY glNormalStream3iATI (GLenum, GLint, GLint, GLint);
+GLAPI void APIENTRY glNormalStream3ivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glNormalStream3fATI (GLenum, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glNormalStream3fvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glNormalStream3dATI (GLenum, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glNormalStream3dvATI (GLenum, const GLdouble *);
+GLAPI void APIENTRY glClientActiveVertexStreamATI (GLenum);
+GLAPI void APIENTRY glVertexBlendEnviATI (GLenum, GLint);
+GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum, GLfloat);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (APIENTRYP PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream);
+typedef void (APIENTRYP PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param);
+#endif
+
+#ifndef GL_ATI_element_array
+#define GL_ATI_element_array 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glElementPointerATI (GLenum, const GLvoid *);
+GLAPI void APIENTRY glDrawElementArrayATI (GLenum, GLsizei);
+GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum, GLuint, GLuint, GLsizei);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count);
+typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count);
+#endif
+
+#ifndef GL_SUN_mesh_array
+#define GL_SUN_mesh_array 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDrawMeshArraysSUN (GLenum, GLint, GLsizei, GLsizei);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width);
+#endif
+
+#ifndef GL_SUN_slice_accum
+#define GL_SUN_slice_accum 1
+#endif
+
+#ifndef GL_NV_multisample_filter_hint
+#define GL_NV_multisample_filter_hint 1
+#endif
+
+#ifndef GL_NV_depth_clamp
+#define GL_NV_depth_clamp 1
+#endif
+
+#ifndef GL_NV_occlusion_query
+#define GL_NV_occlusion_query 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glGenOcclusionQueriesNV (GLsizei, GLuint *);
+GLAPI void APIENTRY glDeleteOcclusionQueriesNV (GLsizei, const GLuint *);
+GLAPI GLboolean APIENTRY glIsOcclusionQueryNV (GLuint);
+GLAPI void APIENTRY glBeginOcclusionQueryNV (GLuint);
+GLAPI void APIENTRY glEndOcclusionQueryNV (void);
+GLAPI void APIENTRY glGetOcclusionQueryivNV (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetOcclusionQueryuivNV (GLuint, GLenum, GLuint *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint *ids);
+typedef void (APIENTRYP PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint *ids);
+typedef GLboolean (APIENTRYP PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id);
+typedef void (APIENTRYP PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id);
+typedef void (APIENTRYP PFNGLENDOCCLUSIONQUERYNVPROC) (void);
+typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params);
+#endif
+
+#ifndef GL_NV_point_sprite
+#define GL_NV_point_sprite 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPointParameteriNV (GLenum, GLint);
+GLAPI void APIENTRY glPointParameterivNV (GLenum, const GLint *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params);
+#endif
+
+#ifndef GL_NV_texture_shader3
+#define GL_NV_texture_shader3 1
+#endif
+
+#ifndef GL_NV_vertex_program1_1
+#define GL_NV_vertex_program1_1 1
+#endif
+
+#ifndef GL_EXT_shadow_funcs
+#define GL_EXT_shadow_funcs 1
+#endif
+
+#ifndef GL_EXT_stencil_two_side
+#define GL_EXT_stencil_two_side 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face);
+#endif
+
+#ifndef GL_ATI_text_fragment_shader
+#define GL_ATI_text_fragment_shader 1
+#endif
+
+#ifndef GL_APPLE_client_storage
+#define GL_APPLE_client_storage 1
+#endif
+
+#ifndef GL_APPLE_element_array
+#define GL_APPLE_element_array 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glElementPointerAPPLE (GLenum, const GLvoid *);
+GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum, GLint, GLsizei);
+GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, GLint, GLsizei);
+GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum, const GLint *, const GLsizei *, GLsizei);
+GLAPI void APIENTRY glMultiDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, const GLint *, const GLsizei *, GLsizei);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count);
+typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count);
+typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount);
+typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount);
+#endif
+
+#ifndef GL_APPLE_fence
+#define GL_APPLE_fence 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glGenFencesAPPLE (GLsizei, GLuint *);
+GLAPI void APIENTRY glDeleteFencesAPPLE (GLsizei, const GLuint *);
+GLAPI void APIENTRY glSetFenceAPPLE (GLuint);
+GLAPI GLboolean APIENTRY glIsFenceAPPLE (GLuint);
+GLAPI GLboolean APIENTRY glTestFenceAPPLE (GLuint);
+GLAPI void APIENTRY glFinishFenceAPPLE (GLuint);
+GLAPI GLboolean APIENTRY glTestObjectAPPLE (GLenum, GLuint);
+GLAPI void APIENTRY glFinishObjectAPPLE (GLenum, GLint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences);
+typedef void (APIENTRYP PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences);
+typedef void (APIENTRYP PFNGLSETFENCEAPPLEPROC) (GLuint fence);
+typedef GLboolean (APIENTRYP PFNGLISFENCEAPPLEPROC) (GLuint fence);
+typedef GLboolean (APIENTRYP PFNGLTESTFENCEAPPLEPROC) (GLuint fence);
+typedef void (APIENTRYP PFNGLFINISHFENCEAPPLEPROC) (GLuint fence);
+typedef GLboolean (APIENTRYP PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name);
+typedef void (APIENTRYP PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name);
+#endif
+
+#ifndef GL_APPLE_vertex_array_object
+#define GL_APPLE_vertex_array_object 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBindVertexArrayAPPLE (GLuint);
+GLAPI void APIENTRY glDeleteVertexArraysAPPLE (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenVertexArraysAPPLE (GLsizei, const GLuint *);
+GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array);
+typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays);
+typedef void (APIENTRYP PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays);
+typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array);
+#endif
+
+#ifndef GL_APPLE_vertex_array_range
+#define GL_APPLE_vertex_array_range 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei, GLvoid *);
+GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei, GLvoid *);
+GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum, GLint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer);
+typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer);
+typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param);
+#endif
+
+#ifndef GL_APPLE_ycbcr_422
+#define GL_APPLE_ycbcr_422 1
+#endif
+
+#ifndef GL_S3_s3tc
+#define GL_S3_s3tc 1
+#endif
+
+#ifndef GL_ATI_draw_buffers
+#define GL_ATI_draw_buffers 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDrawBuffersATI (GLsizei, const GLenum *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs);
+#endif
+
+#ifndef GL_ATI_pixel_format_float
+#define GL_ATI_pixel_format_float 1
+/* This is really a WGL extension, but defines some associated GL enums.
+ * ATI does not export "GL_ATI_pixel_format_float" in the GL_EXTENSIONS string.
+ */
+#endif
+
+#ifndef GL_ATI_texture_env_combine3
+#define GL_ATI_texture_env_combine3 1
+#endif
+
+#ifndef GL_ATI_texture_float
+#define GL_ATI_texture_float 1
+#endif
+
+#ifndef GL_NV_float_buffer
+#define GL_NV_float_buffer 1
+#endif
+
+#ifndef GL_NV_fragment_program
+#define GL_NV_fragment_program 1
+/* Some NV_fragment_program entry points are shared with ARB_vertex_program. */
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glProgramNamedParameter4fNV (GLuint, GLsizei, const GLubyte *, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glProgramNamedParameter4dNV (GLuint, GLsizei, const GLubyte *, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glProgramNamedParameter4fvNV (GLuint, GLsizei, const GLubyte *, const GLfloat *);
+GLAPI void APIENTRY glProgramNamedParameter4dvNV (GLuint, GLsizei, const GLubyte *, const GLdouble *);
+GLAPI void APIENTRY glGetProgramNamedParameterfvNV (GLuint, GLsizei, const GLubyte *, GLfloat *);
+GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint, GLsizei, const GLubyte *, GLdouble *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v);
+typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v);
+typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params);
+#endif
+
+#ifndef GL_NV_half_float
+#define GL_NV_half_float 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glVertex2hNV (GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertex2hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glVertex3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertex3hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glVertex4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertex4hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glNormal3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glNormal3hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glColor3hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glColor4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glColor4hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glTexCoord1hNV (GLhalfNV);
+GLAPI void APIENTRY glTexCoord1hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glTexCoord2hNV (GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glTexCoord2hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glTexCoord3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glTexCoord3hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glTexCoord4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glTexCoord4hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glMultiTexCoord1hNV (GLenum, GLhalfNV);
+GLAPI void APIENTRY glMultiTexCoord1hvNV (GLenum, const GLhalfNV *);
+GLAPI void APIENTRY glMultiTexCoord2hNV (GLenum, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glMultiTexCoord2hvNV (GLenum, const GLhalfNV *);
+GLAPI void APIENTRY glMultiTexCoord3hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glMultiTexCoord3hvNV (GLenum, const GLhalfNV *);
+GLAPI void APIENTRY glMultiTexCoord4hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glMultiTexCoord4hvNV (GLenum, const GLhalfNV *);
+GLAPI void APIENTRY glFogCoordhNV (GLhalfNV);
+GLAPI void APIENTRY glFogCoordhvNV (const GLhalfNV *);
+GLAPI void APIENTRY glSecondaryColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glSecondaryColor3hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glVertexWeighthNV (GLhalfNV);
+GLAPI void APIENTRY glVertexWeighthvNV (const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttrib1hNV (GLuint, GLhalfNV);
+GLAPI void APIENTRY glVertexAttrib1hvNV (GLuint, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttrib2hNV (GLuint, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertexAttrib2hvNV (GLuint, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttrib3hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertexAttrib3hvNV (GLuint, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttrib4hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertexAttrib4hvNV (GLuint, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttribs1hvNV (GLuint, GLsizei, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttribs2hvNV (GLuint, GLsizei, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttribs3hvNV (GLuint, GLsizei, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint, GLsizei, const GLhalfNV *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y);
+typedef void (APIENTRYP PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z);
+typedef void (APIENTRYP PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w);
+typedef void (APIENTRYP PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz);
+typedef void (APIENTRYP PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue);
+typedef void (APIENTRYP PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha);
+typedef void (APIENTRYP PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLTEXCOORD1HNVPROC) (GLhalfNV s);
+typedef void (APIENTRYP PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2HNVPROC) (GLhalfNV s, GLhalfNV t);
+typedef void (APIENTRYP PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r);
+typedef void (APIENTRYP PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q);
+typedef void (APIENTRYP PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLFOGCOORDHNVPROC) (GLhalfNV fog);
+typedef void (APIENTRYP PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXWEIGHTHNVPROC) (GLhalfNV weight);
+typedef void (APIENTRYP PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
+#endif
+
+#ifndef GL_NV_pixel_data_range
+#define GL_NV_pixel_data_range 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPixelDataRangeNV (GLenum, GLsizei, GLvoid *);
+GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, GLvoid *pointer);
+typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target);
+#endif
+
+#ifndef GL_NV_primitive_restart
+#define GL_NV_primitive_restart 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glPrimitiveRestartNV (void);
+GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLPRIMITIVERESTARTNVPROC) (void);
+typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index);
+#endif
+
+#ifndef GL_NV_texture_expand_normal
+#define GL_NV_texture_expand_normal 1
+#endif
+
+#ifndef GL_NV_vertex_program2
+#define GL_NV_vertex_program2 1
+#endif
+
+#ifndef GL_ATI_map_object_buffer
+#define GL_ATI_map_object_buffer 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI GLvoid* APIENTRY glMapObjectBufferATI (GLuint);
+GLAPI void APIENTRY glUnmapObjectBufferATI (GLuint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef GLvoid* (APIENTRYP PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer);
+typedef void (APIENTRYP PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer);
+#endif
+
+#ifndef GL_ATI_separate_stencil
+#define GL_ATI_separate_stencil 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glStencilOpSeparateATI (GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum, GLenum, GLint, GLuint);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
+typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
+#endif
+
+#ifndef GL_ATI_vertex_attrib_array_object
+#define GL_ATI_vertex_attrib_array_object 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glVertexAttribArrayObjectATI (GLuint, GLint, GLenum, GLboolean, GLsizei, GLuint, GLuint);
+GLAPI void APIENTRY glGetVertexAttribArrayObjectfvATI (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVertexAttribArrayObjectivATI (GLuint, GLenum, GLint *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params);
+#endif
+
+#ifndef GL_OES_read_format
+#define GL_OES_read_format 1
+#endif
+
+#ifndef GL_EXT_depth_bounds_test
+#define GL_EXT_depth_bounds_test 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDepthBoundsEXT (GLclampd, GLclampd);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax);
+#endif
+
+#ifndef GL_EXT_texture_mirror_clamp
+#define GL_EXT_texture_mirror_clamp 1
+#endif
+
+#ifndef GL_EXT_blend_equation_separate
+#define GL_EXT_blend_equation_separate 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBlendEquationSeparateEXT (GLenum, GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha);
+#endif
+
+#ifndef GL_MESA_pack_invert
+#define GL_MESA_pack_invert 1
+#endif
+
+#ifndef GL_MESA_ycbcr_texture
+#define GL_MESA_ycbcr_texture 1
+#endif
+
+#ifndef GL_EXT_pixel_buffer_object
+#define GL_EXT_pixel_buffer_object 1
+#endif
+
+#ifndef GL_NV_fragment_program_option
+#define GL_NV_fragment_program_option 1
+#endif
+
+#ifndef GL_NV_fragment_program2
+#define GL_NV_fragment_program2 1
+#endif
+
+#ifndef GL_NV_vertex_program2_option
+#define GL_NV_vertex_program2_option 1
+#endif
+
+#ifndef GL_NV_vertex_program3
+#define GL_NV_vertex_program3 1
+#endif
+
+#ifndef GL_EXT_framebuffer_object
+#define GL_EXT_framebuffer_object 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI GLboolean APIENTRY glIsRenderbufferEXT (GLuint);
+GLAPI void APIENTRY glBindRenderbufferEXT (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteRenderbuffersEXT (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenRenderbuffersEXT (GLsizei, GLuint *);
+GLAPI void APIENTRY glRenderbufferStorageEXT (GLenum, GLenum, GLsizei, GLsizei);
+GLAPI void APIENTRY glGetRenderbufferParameterivEXT (GLenum, GLenum, GLint *);
+GLAPI GLboolean APIENTRY glIsFramebufferEXT (GLuint);
+GLAPI void APIENTRY glBindFramebufferEXT (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteFramebuffersEXT (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenFramebuffersEXT (GLsizei, GLuint *);
+GLAPI GLenum APIENTRY glCheckFramebufferStatusEXT (GLenum);
+GLAPI void APIENTRY glFramebufferTexture1DEXT (GLenum, GLenum, GLenum, GLuint, GLint);
+GLAPI void APIENTRY glFramebufferTexture2DEXT (GLenum, GLenum, GLenum, GLuint, GLint);
+GLAPI void APIENTRY glFramebufferTexture3DEXT (GLenum, GLenum, GLenum, GLuint, GLint, GLint);
+GLAPI void APIENTRY glFramebufferRenderbufferEXT (GLenum, GLenum, GLenum, GLuint);
+GLAPI void APIENTRY glGetFramebufferAttachmentParameterivEXT (GLenum, GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGenerateMipmapEXT (GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer);
+typedef void (APIENTRYP PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer);
+typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint *renderbuffers);
+typedef void (APIENTRYP PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint *renderbuffers);
+typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
+typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer);
+typedef void (APIENTRYP PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer);
+typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint *framebuffers);
+typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint *framebuffers);
+typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset);
+typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
+typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGENERATEMIPMAPEXTPROC) (GLenum target);
+#endif
+
+#ifndef GL_GREMEDY_string_marker
+#define GL_GREMEDY_string_marker 1
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei, const GLvoid *);
+#endif /* GL_GLEXT_PROTOTYPES */
+typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string);
+#endif
+
+
+#ifdef __cplusplus
+}
+#endif
+
+#endif
+#endif /* NO_SDL_GLEXT */
+/*@}*/
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_platform.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_platform.h
new file mode 100644
index 000000000..11d867366
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_platform.h
@@ -0,0 +1,110 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_platform.h
+ * Try to get a standard set of platform defines
+ */
+
+#ifndef _SDL_platform_h
+#define _SDL_platform_h
+
+#if defined(_AIX)
+#undef __AIX__
+#define __AIX__ 1
+#endif
+#if defined(__BEOS__)
+#undef __BEOS__
+#define __BEOS__ 1
+#endif
+#if defined(__HAIKU__)
+#undef __HAIKU__
+#define __HAIKU__ 1
+#endif
+#if defined(bsdi) || defined(__bsdi) || defined(__bsdi__)
+#undef __BSDI__
+#define __BSDI__ 1
+#endif
+#if defined(_arch_dreamcast)
+#undef __DREAMCAST__
+#define __DREAMCAST__ 1
+#endif
+#if defined(__FreeBSD__) || defined(__FreeBSD_kernel__) || defined(__DragonFly__)
+#undef __FREEBSD__
+#define __FREEBSD__ 1
+#endif
+#if defined(__HAIKU__)
+#undef __HAIKU__
+#define __HAIKU__ 1
+#endif
+#if defined(hpux) || defined(__hpux) || defined(__hpux__)
+#undef __HPUX__
+#define __HPUX__ 1
+#endif
+#if defined(sgi) || defined(__sgi) || defined(__sgi__) || defined(_SGI_SOURCE)
+#undef __IRIX__
+#define __IRIX__ 1
+#endif
+#if defined(linux) || defined(__linux) || defined(__linux__)
+#undef __LINUX__
+#define __LINUX__ 1
+#endif
+#if defined(__APPLE__)
+#undef __MACOSX__
+#define __MACOSX__ 1
+#elif defined(macintosh)
+#undef __MACOS__
+#define __MACOS__ 1
+#endif
+#if defined(__NetBSD__)
+#undef __NETBSD__
+#define __NETBSD__ 1
+#endif
+#if defined(__OpenBSD__)
+#undef __OPENBSD__
+#define __OPENBSD__ 1
+#endif
+#if defined(__OS2__)
+#undef __OS2__
+#define __OS2__ 1
+#endif
+#if defined(osf) || defined(__osf) || defined(__osf__) || defined(_OSF_SOURCE)
+#undef __OSF__
+#define __OSF__ 1
+#endif
+#if defined(__QNXNTO__)
+#undef __QNXNTO__
+#define __QNXNTO__ 1
+#endif
+#if defined(riscos) || defined(__riscos) || defined(__riscos__)
+#undef __RISCOS__
+#define __RISCOS__ 1
+#endif
+#if defined(__SVR4)
+#undef __SOLARIS__
+#define __SOLARIS__ 1
+#endif
+#if defined(WIN32) || defined(_WIN32)
+#undef __WIN32__
+#define __WIN32__ 1
+#endif
+
+#endif /* _SDL_platform_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_quit.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_quit.h
new file mode 100644
index 000000000..6d82e7e06
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_quit.h
@@ -0,0 +1,55 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_quit.h
+ * Include file for SDL quit event handling
+ */
+
+#ifndef _SDL_quit_h
+#define _SDL_quit_h
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+
+/** @file SDL_quit.h
+ * An SDL_QUITEVENT is generated when the user tries to close the application
+ * window. If it is ignored or filtered out, the window will remain open.
+ * If it is not ignored or filtered, it is queued normally and the window
+ * is allowed to close. When the window is closed, screen updates will
+ * complete, but have no effect.
+ *
+ * SDL_Init() installs signal handlers for SIGINT (keyboard interrupt)
+ * and SIGTERM (system termination request), if handlers do not already
+ * exist, that generate SDL_QUITEVENT events as well. There is no way
+ * to determine the cause of an SDL_QUITEVENT, but setting a signal
+ * handler in your application will override the default generation of
+ * quit events for that signal.
+ */
+
+/** @file SDL_quit.h
+ * There are no functions directly affecting the quit event
+ */
+
+#define SDL_QuitRequested() \
+ (SDL_PumpEvents(), SDL_PeepEvents(NULL,0,SDL_PEEKEVENT,SDL_QUITMASK))
+
+#endif /* _SDL_quit_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_rwops.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_rwops.h
new file mode 100644
index 000000000..a450119f1
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_rwops.h
@@ -0,0 +1,155 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_rwops.h
+ * This file provides a general interface for SDL to read and write
+ * data sources. It can easily be extended to files, memory, etc.
+ */
+
+#ifndef _SDL_rwops_h
+#define _SDL_rwops_h
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** This is the read/write operation structure -- very basic */
+
+typedef struct SDL_RWops {
+ /** Seek to 'offset' relative to whence, one of stdio's whence values:
+ * SEEK_SET, SEEK_CUR, SEEK_END
+ * Returns the final offset in the data source.
+ */
+ int (SDLCALL *seek)(struct SDL_RWops *context, int offset, int whence);
+
+ /** Read up to 'maxnum' objects each of size 'size' from the data
+ * source to the area pointed at by 'ptr'.
+ * Returns the number of objects read, or -1 if the read failed.
+ */
+ int (SDLCALL *read)(struct SDL_RWops *context, void *ptr, int size, int maxnum);
+
+ /** Write exactly 'num' objects each of size 'objsize' from the area
+ * pointed at by 'ptr' to data source.
+ * Returns 'num', or -1 if the write failed.
+ */
+ int (SDLCALL *write)(struct SDL_RWops *context, const void *ptr, int size, int num);
+
+ /** Close and free an allocated SDL_FSops structure */
+ int (SDLCALL *close)(struct SDL_RWops *context);
+
+ Uint32 type;
+ union {
+#if defined(__WIN32__) && !defined(__SYMBIAN32__)
+ struct {
+ int append;
+ void *h;
+ struct {
+ void *data;
+ int size;
+ int left;
+ } buffer;
+ } win32io;
+#endif
+#ifdef HAVE_STDIO_H
+ struct {
+ int autoclose;
+ FILE *fp;
+ } stdio;
+#endif
+ struct {
+ Uint8 *base;
+ Uint8 *here;
+ Uint8 *stop;
+ } mem;
+ struct {
+ void *data1;
+ } unknown;
+ } hidden;
+
+} SDL_RWops;
+
+
+/** @name Functions to create SDL_RWops structures from various data sources */
+/*@{*/
+
+extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromFile(const char *file, const char *mode);
+
+#ifdef HAVE_STDIO_H
+extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromFP(FILE *fp, int autoclose);
+#endif
+
+extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromMem(void *mem, int size);
+extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromConstMem(const void *mem, int size);
+
+extern DECLSPEC SDL_RWops * SDLCALL SDL_AllocRW(void);
+extern DECLSPEC void SDLCALL SDL_FreeRW(SDL_RWops *area);
+
+/*@}*/
+
+/** @name Seek Reference Points */
+/*@{*/
+#define RW_SEEK_SET 0 /**< Seek from the beginning of data */
+#define RW_SEEK_CUR 1 /**< Seek relative to current read point */
+#define RW_SEEK_END 2 /**< Seek relative to the end of data */
+/*@}*/
+
+/** @name Macros to easily read and write from an SDL_RWops structure */
+/*@{*/
+#define SDL_RWseek(ctx, offset, whence) (ctx)->seek(ctx, offset, whence)
+#define SDL_RWtell(ctx) (ctx)->seek(ctx, 0, RW_SEEK_CUR)
+#define SDL_RWread(ctx, ptr, size, n) (ctx)->read(ctx, ptr, size, n)
+#define SDL_RWwrite(ctx, ptr, size, n) (ctx)->write(ctx, ptr, size, n)
+#define SDL_RWclose(ctx) (ctx)->close(ctx)
+/*@}*/
+
+/** @name Read an item of the specified endianness and return in native format */
+/*@{*/
+extern DECLSPEC Uint16 SDLCALL SDL_ReadLE16(SDL_RWops *src);
+extern DECLSPEC Uint16 SDLCALL SDL_ReadBE16(SDL_RWops *src);
+extern DECLSPEC Uint32 SDLCALL SDL_ReadLE32(SDL_RWops *src);
+extern DECLSPEC Uint32 SDLCALL SDL_ReadBE32(SDL_RWops *src);
+extern DECLSPEC Uint64 SDLCALL SDL_ReadLE64(SDL_RWops *src);
+extern DECLSPEC Uint64 SDLCALL SDL_ReadBE64(SDL_RWops *src);
+/*@}*/
+
+/** @name Write an item of native format to the specified endianness */
+/*@{*/
+extern DECLSPEC int SDLCALL SDL_WriteLE16(SDL_RWops *dst, Uint16 value);
+extern DECLSPEC int SDLCALL SDL_WriteBE16(SDL_RWops *dst, Uint16 value);
+extern DECLSPEC int SDLCALL SDL_WriteLE32(SDL_RWops *dst, Uint32 value);
+extern DECLSPEC int SDLCALL SDL_WriteBE32(SDL_RWops *dst, Uint32 value);
+extern DECLSPEC int SDLCALL SDL_WriteLE64(SDL_RWops *dst, Uint64 value);
+extern DECLSPEC int SDLCALL SDL_WriteBE64(SDL_RWops *dst, Uint64 value);
+/*@}*/
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_rwops_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_stdinc.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_stdinc.h
new file mode 100644
index 000000000..e1f85fb75
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_stdinc.h
@@ -0,0 +1,620 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_stdinc.h
+ * This is a general header that includes C language support
+ */
+
+#ifndef _SDL_stdinc_h
+#define _SDL_stdinc_h
+
+#include "SDL_config.h"
+
+
+#ifdef HAVE_SYS_TYPES_H
+#include
+#endif
+#ifdef HAVE_STDIO_H
+#include
+#endif
+#if defined(STDC_HEADERS)
+# include
+# include
+# include
+#else
+# if defined(HAVE_STDLIB_H)
+# include
+# elif defined(HAVE_MALLOC_H)
+# include
+# endif
+# if defined(HAVE_STDDEF_H)
+# include
+# endif
+# if defined(HAVE_STDARG_H)
+# include
+# endif
+#endif
+#ifdef HAVE_STRING_H
+# if !defined(STDC_HEADERS) && defined(HAVE_MEMORY_H)
+# include
+# endif
+# include
+#endif
+#ifdef HAVE_STRINGS_H
+# include
+#endif
+#if defined(HAVE_INTTYPES_H)
+# include
+#elif defined(HAVE_STDINT_H)
+# include
+#endif
+#ifdef HAVE_CTYPE_H
+# include
+#endif
+#if defined(HAVE_ICONV) && defined(HAVE_ICONV_H)
+# include
+#endif
+
+/** The number of elements in an array */
+#define SDL_arraysize(array) (sizeof(array)/sizeof(array[0]))
+#define SDL_TABLESIZE(table) SDL_arraysize(table)
+
+/* Use proper C++ casts when compiled as C++ to be compatible with the option
+ -Wold-style-cast of GCC (and -Werror=old-style-cast in GCC 4.2 and above. */
+#ifdef __cplusplus
+#define SDL_reinterpret_cast(type, expression) reinterpret_cast(expression)
+#define SDL_static_cast(type, expression) static_cast(expression)
+#else
+#define SDL_reinterpret_cast(type, expression) ((type)(expression))
+#define SDL_static_cast(type, expression) ((type)(expression))
+#endif
+
+/** @name Basic data types */
+/*@{*/
+typedef enum {
+ SDL_FALSE = 0,
+ SDL_TRUE = 1
+} SDL_bool;
+
+typedef int8_t Sint8;
+typedef uint8_t Uint8;
+typedef int16_t Sint16;
+typedef uint16_t Uint16;
+typedef int32_t Sint32;
+typedef uint32_t Uint32;
+
+#ifdef SDL_HAS_64BIT_TYPE
+typedef int64_t Sint64;
+#ifndef SYMBIAN32_GCCE
+typedef uint64_t Uint64;
+#endif
+#else
+/* This is really just a hack to prevent the compiler from complaining */
+typedef struct {
+ Uint32 hi;
+ Uint32 lo;
+} Uint64, Sint64;
+#endif
+
+/*@}*/
+
+/** @name Make sure the types really have the right sizes */
+/*@{*/
+#define SDL_COMPILE_TIME_ASSERT(name, x) \
+ typedef int SDL_dummy_ ## name[(x) * 2 - 1]
+
+SDL_COMPILE_TIME_ASSERT(uint8, sizeof(Uint8) == 1);
+SDL_COMPILE_TIME_ASSERT(sint8, sizeof(Sint8) == 1);
+SDL_COMPILE_TIME_ASSERT(uint16, sizeof(Uint16) == 2);
+SDL_COMPILE_TIME_ASSERT(sint16, sizeof(Sint16) == 2);
+SDL_COMPILE_TIME_ASSERT(uint32, sizeof(Uint32) == 4);
+SDL_COMPILE_TIME_ASSERT(sint32, sizeof(Sint32) == 4);
+SDL_COMPILE_TIME_ASSERT(uint64, sizeof(Uint64) == 8);
+SDL_COMPILE_TIME_ASSERT(sint64, sizeof(Sint64) == 8);
+/*@}*/
+
+/** @name Enum Size Check
+ * Check to make sure enums are the size of ints, for structure packing.
+ * For both Watcom C/C++ and Borland C/C++ the compiler option that makes
+ * enums having the size of an int must be enabled.
+ * This is "-b" for Borland C/C++ and "-ei" for Watcom C/C++ (v11).
+ */
+/* Enable enums always int in CodeWarrior (for MPW use "-enum int") */
+#ifdef __MWERKS__
+#pragma enumsalwaysint on
+#endif
+
+typedef enum {
+ DUMMY_ENUM_VALUE
+} SDL_DUMMY_ENUM;
+
+#ifndef __NDS__
+SDL_COMPILE_TIME_ASSERT(enum, sizeof(SDL_DUMMY_ENUM) == sizeof(int));
+#endif
+/*@}*/
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#ifdef HAVE_MALLOC
+#define SDL_malloc malloc
+#else
+extern DECLSPEC void * SDLCALL SDL_malloc(size_t size);
+#endif
+
+#ifdef HAVE_CALLOC
+#define SDL_calloc calloc
+#else
+extern DECLSPEC void * SDLCALL SDL_calloc(size_t nmemb, size_t size);
+#endif
+
+#ifdef HAVE_REALLOC
+#define SDL_realloc realloc
+#else
+extern DECLSPEC void * SDLCALL SDL_realloc(void *mem, size_t size);
+#endif
+
+#ifdef HAVE_FREE
+#define SDL_free free
+#else
+extern DECLSPEC void SDLCALL SDL_free(void *mem);
+#endif
+
+#if defined(HAVE_ALLOCA) && !defined(alloca)
+# if defined(HAVE_ALLOCA_H)
+# include
+# elif defined(__GNUC__)
+# define alloca __builtin_alloca
+# elif defined(_MSC_VER)
+# include
+# define alloca _alloca
+# elif defined(__WATCOMC__)
+# include
+# elif defined(__BORLANDC__)
+# include
+# elif defined(__DMC__)
+# include
+# elif defined(__AIX__)
+ #pragma alloca
+# elif defined(__MRC__)
+ void *alloca (unsigned);
+# else
+ char *alloca ();
+# endif
+#endif
+#ifdef HAVE_ALLOCA
+#define SDL_stack_alloc(type, count) (type*)alloca(sizeof(type)*(count))
+#define SDL_stack_free(data)
+#else
+#define SDL_stack_alloc(type, count) (type*)SDL_malloc(sizeof(type)*(count))
+#define SDL_stack_free(data) SDL_free(data)
+#endif
+
+#ifdef HAVE_GETENV
+#define SDL_getenv getenv
+#else
+extern DECLSPEC char * SDLCALL SDL_getenv(const char *name);
+#endif
+
+#ifdef HAVE_PUTENV
+#define SDL_putenv putenv
+#else
+extern DECLSPEC int SDLCALL SDL_putenv(const char *variable);
+#endif
+
+#ifdef HAVE_QSORT
+#define SDL_qsort qsort
+#else
+extern DECLSPEC void SDLCALL SDL_qsort(void *base, size_t nmemb, size_t size,
+ int (*compare)(const void *, const void *));
+#endif
+
+#ifdef HAVE_ABS
+#define SDL_abs abs
+#else
+#define SDL_abs(X) ((X) < 0 ? -(X) : (X))
+#endif
+
+#define SDL_min(x, y) (((x) < (y)) ? (x) : (y))
+#define SDL_max(x, y) (((x) > (y)) ? (x) : (y))
+
+#ifdef HAVE_CTYPE_H
+#define SDL_isdigit(X) isdigit(X)
+#define SDL_isspace(X) isspace(X)
+#define SDL_toupper(X) toupper(X)
+#define SDL_tolower(X) tolower(X)
+#else
+#define SDL_isdigit(X) (((X) >= '0') && ((X) <= '9'))
+#define SDL_isspace(X) (((X) == ' ') || ((X) == '\t') || ((X) == '\r') || ((X) == '\n'))
+#define SDL_toupper(X) (((X) >= 'a') && ((X) <= 'z') ? ('A'+((X)-'a')) : (X))
+#define SDL_tolower(X) (((X) >= 'A') && ((X) <= 'Z') ? ('a'+((X)-'A')) : (X))
+#endif
+
+#ifdef HAVE_MEMSET
+#define SDL_memset memset
+#else
+extern DECLSPEC void * SDLCALL SDL_memset(void *dst, int c, size_t len);
+#endif
+
+#if defined(__GNUC__) && defined(i386)
+#define SDL_memset4(dst, val, len) \
+do { \
+ int u0, u1, u2; \
+ __asm__ __volatile__ ( \
+ "cld\n\t" \
+ "rep ; stosl\n\t" \
+ : "=&D" (u0), "=&a" (u1), "=&c" (u2) \
+ : "0" (dst), "1" (val), "2" (SDL_static_cast(Uint32, len)) \
+ : "memory" ); \
+} while(0)
+#endif
+#ifndef SDL_memset4
+#define SDL_memset4(dst, val, len) \
+do { \
+ unsigned _count = (len); \
+ unsigned _n = (_count + 3) / 4; \
+ Uint32 *_p = SDL_static_cast(Uint32 *, dst); \
+ Uint32 _val = (val); \
+ if (len == 0) break; \
+ switch (_count % 4) { \
+ case 0: do { *_p++ = _val; \
+ case 3: *_p++ = _val; \
+ case 2: *_p++ = _val; \
+ case 1: *_p++ = _val; \
+ } while ( --_n ); \
+ } \
+} while(0)
+#endif
+
+/* We can count on memcpy existing on Mac OS X and being well-tuned. */
+#if defined(__MACH__) && defined(__APPLE__)
+#define SDL_memcpy(dst, src, len) memcpy(dst, src, len)
+#elif defined(__GNUC__) && defined(i386)
+#define SDL_memcpy(dst, src, len) \
+do { \
+ int u0, u1, u2; \
+ __asm__ __volatile__ ( \
+ "cld\n\t" \
+ "rep ; movsl\n\t" \
+ "testb $2,%b4\n\t" \
+ "je 1f\n\t" \
+ "movsw\n" \
+ "1:\ttestb $1,%b4\n\t" \
+ "je 2f\n\t" \
+ "movsb\n" \
+ "2:" \
+ : "=&c" (u0), "=&D" (u1), "=&S" (u2) \
+ : "0" (SDL_static_cast(unsigned, len)/4), "q" (len), "1" (dst),"2" (src) \
+ : "memory" ); \
+} while(0)
+#endif
+#ifndef SDL_memcpy
+#ifdef HAVE_MEMCPY
+#define SDL_memcpy memcpy
+#elif defined(HAVE_BCOPY)
+#define SDL_memcpy(d, s, n) bcopy((s), (d), (n))
+#else
+extern DECLSPEC void * SDLCALL SDL_memcpy(void *dst, const void *src, size_t len);
+#endif
+#endif
+
+/* We can count on memcpy existing on Mac OS X and being well-tuned. */
+#if defined(__MACH__) && defined(__APPLE__)
+#define SDL_memcpy4(dst, src, len) memcpy(dst, src, (len)*4)
+#elif defined(__GNUC__) && defined(i386)
+#define SDL_memcpy4(dst, src, len) \
+do { \
+ int ecx, edi, esi; \
+ __asm__ __volatile__ ( \
+ "cld\n\t" \
+ "rep ; movsl" \
+ : "=&c" (ecx), "=&D" (edi), "=&S" (esi) \
+ : "0" (SDL_static_cast(unsigned, len)), "1" (dst), "2" (src) \
+ : "memory" ); \
+} while(0)
+#endif
+#ifndef SDL_memcpy4
+#define SDL_memcpy4(dst, src, len) SDL_memcpy(dst, src, (len) << 2)
+#endif
+
+#if defined(__GNUC__) && defined(i386)
+#define SDL_revcpy(dst, src, len) \
+do { \
+ int u0, u1, u2; \
+ char *dstp = SDL_static_cast(char *, dst); \
+ char *srcp = SDL_static_cast(char *, src); \
+ int n = (len); \
+ if ( n >= 4 ) { \
+ __asm__ __volatile__ ( \
+ "std\n\t" \
+ "rep ; movsl\n\t" \
+ "cld\n\t" \
+ : "=&c" (u0), "=&D" (u1), "=&S" (u2) \
+ : "0" (n >> 2), \
+ "1" (dstp+(n-4)), "2" (srcp+(n-4)) \
+ : "memory" ); \
+ } \
+ switch (n & 3) { \
+ case 3: dstp[2] = srcp[2]; \
+ case 2: dstp[1] = srcp[1]; \
+ case 1: dstp[0] = srcp[0]; \
+ break; \
+ default: \
+ break; \
+ } \
+} while(0)
+#endif
+#ifndef SDL_revcpy
+extern DECLSPEC void * SDLCALL SDL_revcpy(void *dst, const void *src, size_t len);
+#endif
+
+#ifdef HAVE_MEMMOVE
+#define SDL_memmove memmove
+#elif defined(HAVE_BCOPY)
+#define SDL_memmove(d, s, n) bcopy((s), (d), (n))
+#else
+#define SDL_memmove(dst, src, len) \
+do { \
+ if ( dst < src ) { \
+ SDL_memcpy(dst, src, len); \
+ } else { \
+ SDL_revcpy(dst, src, len); \
+ } \
+} while(0)
+#endif
+
+#ifdef HAVE_MEMCMP
+#define SDL_memcmp memcmp
+#else
+extern DECLSPEC int SDLCALL SDL_memcmp(const void *s1, const void *s2, size_t len);
+#endif
+
+#ifdef HAVE_STRLEN
+#define SDL_strlen strlen
+#else
+extern DECLSPEC size_t SDLCALL SDL_strlen(const char *string);
+#endif
+
+#ifdef HAVE_STRLCPY
+#define SDL_strlcpy strlcpy
+#else
+extern DECLSPEC size_t SDLCALL SDL_strlcpy(char *dst, const char *src, size_t maxlen);
+#endif
+
+#ifdef HAVE_STRLCAT
+#define SDL_strlcat strlcat
+#else
+extern DECLSPEC size_t SDLCALL SDL_strlcat(char *dst, const char *src, size_t maxlen);
+#endif
+
+#ifdef HAVE_STRDUP
+#define SDL_strdup strdup
+#else
+extern DECLSPEC char * SDLCALL SDL_strdup(const char *string);
+#endif
+
+#ifdef HAVE__STRREV
+#define SDL_strrev _strrev
+#else
+extern DECLSPEC char * SDLCALL SDL_strrev(char *string);
+#endif
+
+#ifdef HAVE__STRUPR
+#define SDL_strupr _strupr
+#else
+extern DECLSPEC char * SDLCALL SDL_strupr(char *string);
+#endif
+
+#ifdef HAVE__STRLWR
+#define SDL_strlwr _strlwr
+#else
+extern DECLSPEC char * SDLCALL SDL_strlwr(char *string);
+#endif
+
+#ifdef HAVE_STRCHR
+#define SDL_strchr strchr
+#elif defined(HAVE_INDEX)
+#define SDL_strchr index
+#else
+extern DECLSPEC char * SDLCALL SDL_strchr(const char *string, int c);
+#endif
+
+#ifdef HAVE_STRRCHR
+#define SDL_strrchr strrchr
+#elif defined(HAVE_RINDEX)
+#define SDL_strrchr rindex
+#else
+extern DECLSPEC char * SDLCALL SDL_strrchr(const char *string, int c);
+#endif
+
+#ifdef HAVE_STRSTR
+#define SDL_strstr strstr
+#else
+extern DECLSPEC char * SDLCALL SDL_strstr(const char *haystack, const char *needle);
+#endif
+
+#ifdef HAVE_ITOA
+#define SDL_itoa itoa
+#else
+#define SDL_itoa(value, string, radix) SDL_ltoa((long)value, string, radix)
+#endif
+
+#ifdef HAVE__LTOA
+#define SDL_ltoa _ltoa
+#else
+extern DECLSPEC char * SDLCALL SDL_ltoa(long value, char *string, int radix);
+#endif
+
+#ifdef HAVE__UITOA
+#define SDL_uitoa _uitoa
+#else
+#define SDL_uitoa(value, string, radix) SDL_ultoa((long)value, string, radix)
+#endif
+
+#ifdef HAVE__ULTOA
+#define SDL_ultoa _ultoa
+#else
+extern DECLSPEC char * SDLCALL SDL_ultoa(unsigned long value, char *string, int radix);
+#endif
+
+#ifdef HAVE_STRTOL
+#define SDL_strtol strtol
+#else
+extern DECLSPEC long SDLCALL SDL_strtol(const char *string, char **endp, int base);
+#endif
+
+#ifdef HAVE_STRTOUL
+#define SDL_strtoul strtoul
+#else
+extern DECLSPEC unsigned long SDLCALL SDL_strtoul(const char *string, char **endp, int base);
+#endif
+
+#ifdef SDL_HAS_64BIT_TYPE
+
+#ifdef HAVE__I64TOA
+#define SDL_lltoa _i64toa
+#else
+extern DECLSPEC char* SDLCALL SDL_lltoa(Sint64 value, char *string, int radix);
+#endif
+
+#ifdef HAVE__UI64TOA
+#define SDL_ulltoa _ui64toa
+#else
+extern DECLSPEC char* SDLCALL SDL_ulltoa(Uint64 value, char *string, int radix);
+#endif
+
+#ifdef HAVE_STRTOLL
+#define SDL_strtoll strtoll
+#else
+extern DECLSPEC Sint64 SDLCALL SDL_strtoll(const char *string, char **endp, int base);
+#endif
+
+#ifdef HAVE_STRTOULL
+#define SDL_strtoull strtoull
+#else
+extern DECLSPEC Uint64 SDLCALL SDL_strtoull(const char *string, char **endp, int base);
+#endif
+
+#endif /* SDL_HAS_64BIT_TYPE */
+
+#ifdef HAVE_STRTOD
+#define SDL_strtod strtod
+#else
+extern DECLSPEC double SDLCALL SDL_strtod(const char *string, char **endp);
+#endif
+
+#ifdef HAVE_ATOI
+#define SDL_atoi atoi
+#else
+#define SDL_atoi(X) SDL_strtol(X, NULL, 0)
+#endif
+
+#ifdef HAVE_ATOF
+#define SDL_atof atof
+#else
+#define SDL_atof(X) SDL_strtod(X, NULL)
+#endif
+
+#ifdef HAVE_STRCMP
+#define SDL_strcmp strcmp
+#else
+extern DECLSPEC int SDLCALL SDL_strcmp(const char *str1, const char *str2);
+#endif
+
+#ifdef HAVE_STRNCMP
+#define SDL_strncmp strncmp
+#else
+extern DECLSPEC int SDLCALL SDL_strncmp(const char *str1, const char *str2, size_t maxlen);
+#endif
+
+#ifdef HAVE_STRCASECMP
+#define SDL_strcasecmp strcasecmp
+#elif defined(HAVE__STRICMP)
+#define SDL_strcasecmp _stricmp
+#else
+extern DECLSPEC int SDLCALL SDL_strcasecmp(const char *str1, const char *str2);
+#endif
+
+#ifdef HAVE_STRNCASECMP
+#define SDL_strncasecmp strncasecmp
+#elif defined(HAVE__STRNICMP)
+#define SDL_strncasecmp _strnicmp
+#else
+extern DECLSPEC int SDLCALL SDL_strncasecmp(const char *str1, const char *str2, size_t maxlen);
+#endif
+
+#ifdef HAVE_SSCANF
+#define SDL_sscanf sscanf
+#else
+extern DECLSPEC int SDLCALL SDL_sscanf(const char *text, const char *fmt, ...);
+#endif
+
+#ifdef HAVE_SNPRINTF
+#define SDL_snprintf snprintf
+#else
+extern DECLSPEC int SDLCALL SDL_snprintf(char *text, size_t maxlen, const char *fmt, ...);
+#endif
+
+#ifdef HAVE_VSNPRINTF
+#define SDL_vsnprintf vsnprintf
+#else
+extern DECLSPEC int SDLCALL SDL_vsnprintf(char *text, size_t maxlen, const char *fmt, va_list ap);
+#endif
+
+/** @name SDL_ICONV Error Codes
+ * The SDL implementation of iconv() returns these error codes
+ */
+/*@{*/
+#define SDL_ICONV_ERROR (size_t)-1
+#define SDL_ICONV_E2BIG (size_t)-2
+#define SDL_ICONV_EILSEQ (size_t)-3
+#define SDL_ICONV_EINVAL (size_t)-4
+/*@}*/
+
+#if defined(HAVE_ICONV) && defined(HAVE_ICONV_H)
+#define SDL_iconv_t iconv_t
+#define SDL_iconv_open iconv_open
+#define SDL_iconv_close iconv_close
+#else
+typedef struct _SDL_iconv_t *SDL_iconv_t;
+extern DECLSPEC SDL_iconv_t SDLCALL SDL_iconv_open(const char *tocode, const char *fromcode);
+extern DECLSPEC int SDLCALL SDL_iconv_close(SDL_iconv_t cd);
+#endif
+extern DECLSPEC size_t SDLCALL SDL_iconv(SDL_iconv_t cd, const char **inbuf, size_t *inbytesleft, char **outbuf, size_t *outbytesleft);
+/** This function converts a string between encodings in one pass, returning a
+ * string that must be freed with SDL_free() or NULL on error.
+ */
+extern DECLSPEC char * SDLCALL SDL_iconv_string(const char *tocode, const char *fromcode, const char *inbuf, size_t inbytesleft);
+#define SDL_iconv_utf8_locale(S) SDL_iconv_string("", "UTF-8", S, SDL_strlen(S)+1)
+#define SDL_iconv_utf8_ucs2(S) (Uint16 *)SDL_iconv_string("UCS-2", "UTF-8", S, SDL_strlen(S)+1)
+#define SDL_iconv_utf8_ucs4(S) (Uint32 *)SDL_iconv_string("UCS-4", "UTF-8", S, SDL_strlen(S)+1)
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_stdinc_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_syswm.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_syswm.h
new file mode 100644
index 000000000..716dddcb7
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_syswm.h
@@ -0,0 +1,225 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_syswm.h
+ * Include file for SDL custom system window manager hooks
+ */
+
+#ifndef _SDL_syswm_h
+#define _SDL_syswm_h
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+#include "SDL_version.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** @file SDL_syswm.h
+ * Your application has access to a special type of event 'SDL_SYSWMEVENT',
+ * which contains window-manager specific information and arrives whenever
+ * an unhandled window event occurs. This event is ignored by default, but
+ * you can enable it with SDL_EventState()
+ */
+#ifdef SDL_PROTOTYPES_ONLY
+struct SDL_SysWMinfo;
+typedef struct SDL_SysWMinfo SDL_SysWMinfo;
+#else
+
+/* This is the structure for custom window manager events */
+#if defined(SDL_VIDEO_DRIVER_X11)
+#if defined(__APPLE__) && defined(__MACH__)
+/* conflicts with Quickdraw.h */
+#define Cursor X11Cursor
+#endif
+
+#include
+#include
+
+#if defined(__APPLE__) && defined(__MACH__)
+/* matches the re-define above */
+#undef Cursor
+#endif
+
+/** These are the various supported subsystems under UNIX */
+typedef enum {
+ SDL_SYSWM_X11
+} SDL_SYSWM_TYPE;
+
+/** The UNIX custom event structure */
+struct SDL_SysWMmsg {
+ SDL_version version;
+ SDL_SYSWM_TYPE subsystem;
+ union {
+ XEvent xevent;
+ } event;
+};
+
+/** The UNIX custom window manager information structure.
+ * When this structure is returned, it holds information about which
+ * low level system it is using, and will be one of SDL_SYSWM_TYPE.
+ */
+typedef struct SDL_SysWMinfo {
+ SDL_version version;
+ SDL_SYSWM_TYPE subsystem;
+ union {
+ struct {
+ Display *display; /**< The X11 display */
+ Window window; /**< The X11 display window */
+ /** These locking functions should be called around
+ * any X11 functions using the display variable,
+ * but not the gfxdisplay variable.
+ * They lock the event thread, so should not be
+ * called around event functions or from event filters.
+ */
+ /*@{*/
+ void (*lock_func)(void);
+ void (*unlock_func)(void);
+ /*@}*/
+
+ /** @name Introduced in SDL 1.0.2 */
+ /*@{*/
+ Window fswindow; /**< The X11 fullscreen window */
+ Window wmwindow; /**< The X11 managed input window */
+ /*@}*/
+
+ /** @name Introduced in SDL 1.2.12 */
+ /*@{*/
+ Display *gfxdisplay; /**< The X11 display to which rendering is done */
+ /*@}*/
+ } x11;
+ } info;
+} SDL_SysWMinfo;
+
+#elif defined(SDL_VIDEO_DRIVER_NANOX)
+#include
+
+/** The generic custom event structure */
+struct SDL_SysWMmsg {
+ SDL_version version;
+ int data;
+};
+
+/** The windows custom window manager information structure */
+typedef struct SDL_SysWMinfo {
+ SDL_version version ;
+ GR_WINDOW_ID window ; /* The display window */
+} SDL_SysWMinfo;
+
+#elif defined(SDL_VIDEO_DRIVER_WINDIB) || defined(SDL_VIDEO_DRIVER_DDRAW) || defined(SDL_VIDEO_DRIVER_GAPI)
+#define WIN32_LEAN_AND_MEAN
+#include
+
+/** The windows custom event structure */
+struct SDL_SysWMmsg {
+ SDL_version version;
+ HWND hwnd; /**< The window for the message */
+ UINT msg; /**< The type of message */
+ WPARAM wParam; /**< WORD message parameter */
+ LPARAM lParam; /**< LONG message parameter */
+};
+
+/** The windows custom window manager information structure */
+typedef struct SDL_SysWMinfo {
+ SDL_version version;
+ HWND window; /**< The Win32 display window */
+ HGLRC hglrc; /**< The OpenGL context, if any */
+} SDL_SysWMinfo;
+
+#elif defined(SDL_VIDEO_DRIVER_RISCOS)
+
+/** RISC OS custom event structure */
+struct SDL_SysWMmsg {
+ SDL_version version;
+ int eventCode; /**< The window for the message */
+ int pollBlock[64];
+};
+
+/** The RISC OS custom window manager information structure */
+typedef struct SDL_SysWMinfo {
+ SDL_version version;
+ int wimpVersion; /**< Wimp version running under */
+ int taskHandle; /**< The RISC OS task handle */
+ int window; /**< The RISC OS display window */
+} SDL_SysWMinfo;
+
+#elif defined(SDL_VIDEO_DRIVER_PHOTON)
+#include
+#include
+
+/** The QNX custom event structure */
+struct SDL_SysWMmsg {
+ SDL_version version;
+ int data;
+};
+
+/** The QNX custom window manager information structure */
+typedef struct SDL_SysWMinfo {
+ SDL_version version;
+ int data;
+} SDL_SysWMinfo;
+
+#else
+
+/** The generic custom event structure */
+struct SDL_SysWMmsg {
+ SDL_version version;
+ int data;
+};
+
+/** The generic custom window manager information structure */
+typedef struct SDL_SysWMinfo {
+ SDL_version version;
+ int data;
+} SDL_SysWMinfo;
+
+#endif /* video driver type */
+
+#endif /* SDL_PROTOTYPES_ONLY */
+
+/* Function prototypes */
+/**
+ * This function gives you custom hooks into the window manager information.
+ * It fills the structure pointed to by 'info' with custom information and
+ * returns 1 if the function is implemented. If it's not implemented, or
+ * the version member of the 'info' structure is invalid, it returns 0.
+ *
+ * You typically use this function like this:
+ * @code
+ * SDL_SysWMInfo info;
+ * SDL_VERSION(&info.version);
+ * if ( SDL_GetWMInfo(&info) ) { ... }
+ * @endcode
+ */
+extern DECLSPEC int SDLCALL SDL_GetWMInfo(SDL_SysWMinfo *info);
+
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_syswm_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_thread.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_thread.h
new file mode 100644
index 000000000..1ca9a1bc4
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_thread.h
@@ -0,0 +1,120 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+#ifndef _SDL_thread_h
+#define _SDL_thread_h
+
+/** @file SDL_thread.h
+ * Header for the SDL thread management routines
+ *
+ * @note These are independent of the other SDL routines.
+ */
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+
+/* Thread synchronization primitives */
+#include "SDL_mutex.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** The SDL thread structure, defined in SDL_thread.c */
+struct SDL_Thread;
+typedef struct SDL_Thread SDL_Thread;
+
+/** Create a thread */
+#if ((defined(__WIN32__) && !defined(HAVE_LIBC)) || defined(__OS2__)) && !defined(__SYMBIAN32__)
+/**
+ * We compile SDL into a DLL on OS/2. This means, that it's the DLL which
+ * creates a new thread for the calling process with the SDL_CreateThread()
+ * API. There is a problem with this, that only the RTL of the SDL.DLL will
+ * be initialized for those threads, and not the RTL of the calling application!
+ * To solve this, we make a little hack here.
+ * We'll always use the caller's _beginthread() and _endthread() APIs to
+ * start a new thread. This way, if it's the SDL.DLL which uses this API,
+ * then the RTL of SDL.DLL will be used to create the new thread, and if it's
+ * the application, then the RTL of the application will be used.
+ * So, in short:
+ * Always use the _beginthread() and _endthread() of the calling runtime library!
+ */
+#define SDL_PASSED_BEGINTHREAD_ENDTHREAD
+#ifndef _WIN32_WCE
+#include /* This has _beginthread() and _endthread() defined! */
+#endif
+
+#ifdef __OS2__
+typedef int (*pfnSDL_CurrentBeginThread)(void (*func)(void *), void *, unsigned, void *arg);
+typedef void (*pfnSDL_CurrentEndThread)(void);
+#elif __GNUC__
+typedef unsigned long (__cdecl *pfnSDL_CurrentBeginThread) (void *, unsigned,
+ unsigned (__stdcall *func)(void *), void *arg,
+ unsigned, unsigned *threadID);
+typedef void (__cdecl *pfnSDL_CurrentEndThread)(unsigned code);
+#else
+typedef uintptr_t (__cdecl *pfnSDL_CurrentBeginThread) (void *, unsigned,
+ unsigned (__stdcall *func)(void *), void *arg,
+ unsigned, unsigned *threadID);
+typedef void (__cdecl *pfnSDL_CurrentEndThread)(unsigned code);
+#endif
+
+extern DECLSPEC SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data, pfnSDL_CurrentBeginThread pfnBeginThread, pfnSDL_CurrentEndThread pfnEndThread);
+
+#ifdef __OS2__
+#define SDL_CreateThread(fn, data) SDL_CreateThread(fn, data, _beginthread, _endthread)
+#elif defined(_WIN32_WCE)
+#define SDL_CreateThread(fn, data) SDL_CreateThread(fn, data, NULL, NULL)
+#else
+#define SDL_CreateThread(fn, data) SDL_CreateThread(fn, data, _beginthreadex, _endthreadex)
+#endif
+#else
+extern DECLSPEC SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data);
+#endif
+
+/** Get the 32-bit thread identifier for the current thread */
+extern DECLSPEC Uint32 SDLCALL SDL_ThreadID(void);
+
+/** Get the 32-bit thread identifier for the specified thread,
+ * equivalent to SDL_ThreadID() if the specified thread is NULL.
+ */
+extern DECLSPEC Uint32 SDLCALL SDL_GetThreadID(SDL_Thread *thread);
+
+/** Wait for a thread to finish.
+ * The return code for the thread function is placed in the area
+ * pointed to by 'status', if 'status' is not NULL.
+ */
+extern DECLSPEC void SDLCALL SDL_WaitThread(SDL_Thread *thread, int *status);
+
+/** Forcefully kill a thread without worrying about its state */
+extern DECLSPEC void SDLCALL SDL_KillThread(SDL_Thread *thread);
+
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_thread_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_timer.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_timer.h
new file mode 100644
index 000000000..d7cd02460
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_timer.h
@@ -0,0 +1,125 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+#ifndef _SDL_timer_h
+#define _SDL_timer_h
+
+/** @file SDL_timer.h
+ * Header for the SDL time management routines
+ */
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** This is the OS scheduler timeslice, in milliseconds */
+#define SDL_TIMESLICE 10
+
+/** This is the maximum resolution of the SDL timer on all platforms */
+#define TIMER_RESOLUTION 10 /**< Experimentally determined */
+
+/**
+ * Get the number of milliseconds since the SDL library initialization.
+ * Note that this value wraps if the program runs for more than ~49 days.
+ */
+extern DECLSPEC Uint32 SDLCALL SDL_GetTicks(void);
+
+/** Wait a specified number of milliseconds before returning */
+extern DECLSPEC void SDLCALL SDL_Delay(Uint32 ms);
+
+/** Function prototype for the timer callback function */
+typedef Uint32 (SDLCALL *SDL_TimerCallback)(Uint32 interval);
+
+/**
+ * Set a callback to run after the specified number of milliseconds has
+ * elapsed. The callback function is passed the current timer interval
+ * and returns the next timer interval. If the returned value is the
+ * same as the one passed in, the periodic alarm continues, otherwise a
+ * new alarm is scheduled. If the callback returns 0, the periodic alarm
+ * is cancelled.
+ *
+ * To cancel a currently running timer, call SDL_SetTimer(0, NULL);
+ *
+ * The timer callback function may run in a different thread than your
+ * main code, and so shouldn't call any functions from within itself.
+ *
+ * The maximum resolution of this timer is 10 ms, which means that if
+ * you request a 16 ms timer, your callback will run approximately 20 ms
+ * later on an unloaded system. If you wanted to set a flag signaling
+ * a frame update at 30 frames per second (every 33 ms), you might set a
+ * timer for 30 ms:
+ * @code SDL_SetTimer((33/10)*10, flag_update); @endcode
+ *
+ * If you use this function, you need to pass SDL_INIT_TIMER to SDL_Init().
+ *
+ * Under UNIX, you should not use raise or use SIGALRM and this function
+ * in the same program, as it is implemented using setitimer(). You also
+ * should not use this function in multi-threaded applications as signals
+ * to multi-threaded apps have undefined behavior in some implementations.
+ *
+ * This function returns 0 if successful, or -1 if there was an error.
+ */
+extern DECLSPEC int SDLCALL SDL_SetTimer(Uint32 interval, SDL_TimerCallback callback);
+
+/** @name New timer API
+ * New timer API, supports multiple timers
+ * Written by Stephane Peter
+ */
+/*@{*/
+
+/**
+ * Function prototype for the new timer callback function.
+ * The callback function is passed the current timer interval and returns
+ * the next timer interval. If the returned value is the same as the one
+ * passed in, the periodic alarm continues, otherwise a new alarm is
+ * scheduled. If the callback returns 0, the periodic alarm is cancelled.
+ */
+typedef Uint32 (SDLCALL *SDL_NewTimerCallback)(Uint32 interval, void *param);
+
+/** Definition of the timer ID type */
+typedef struct _SDL_TimerID *SDL_TimerID;
+
+/** Add a new timer to the pool of timers already running.
+ * Returns a timer ID, or NULL when an error occurs.
+ */
+extern DECLSPEC SDL_TimerID SDLCALL SDL_AddTimer(Uint32 interval, SDL_NewTimerCallback callback, void *param);
+
+/**
+ * Remove one of the multiple timers knowing its ID.
+ * Returns a boolean value indicating success.
+ */
+extern DECLSPEC SDL_bool SDLCALL SDL_RemoveTimer(SDL_TimerID t);
+
+/*@}*/
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_timer_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_types.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_types.h
new file mode 100644
index 000000000..cfa35236a
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_types.h
@@ -0,0 +1,28 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_types.h
+ * @deprecated Use SDL_stdinc.h instead.
+ */
+
+/* DEPRECATED */
+#include "SDL_stdinc.h"
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_version.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_version.h
new file mode 100644
index 000000000..fa02c3f6d
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_version.h
@@ -0,0 +1,91 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_version.h
+ * This header defines the current SDL version
+ */
+
+#ifndef _SDL_version_h
+#define _SDL_version_h
+
+#include "SDL_stdinc.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** @name Version Number
+ * Printable format: "%d.%d.%d", MAJOR, MINOR, PATCHLEVEL
+ */
+/*@{*/
+#define SDL_MAJOR_VERSION 1
+#define SDL_MINOR_VERSION 2
+#define SDL_PATCHLEVEL 14
+/*@}*/
+
+typedef struct SDL_version {
+ Uint8 major;
+ Uint8 minor;
+ Uint8 patch;
+} SDL_version;
+
+/**
+ * This macro can be used to fill a version structure with the compile-time
+ * version of the SDL library.
+ */
+#define SDL_VERSION(X) \
+{ \
+ (X)->major = SDL_MAJOR_VERSION; \
+ (X)->minor = SDL_MINOR_VERSION; \
+ (X)->patch = SDL_PATCHLEVEL; \
+}
+
+/** This macro turns the version numbers into a numeric value:
+ * (1,2,3) -> (1203)
+ * This assumes that there will never be more than 100 patchlevels
+ */
+#define SDL_VERSIONNUM(X, Y, Z) \
+ ((X)*1000 + (Y)*100 + (Z))
+
+/** This is the version number macro for the current SDL version */
+#define SDL_COMPILEDVERSION \
+ SDL_VERSIONNUM(SDL_MAJOR_VERSION, SDL_MINOR_VERSION, SDL_PATCHLEVEL)
+
+/** This macro will evaluate to true if compiled with SDL at least X.Y.Z */
+#define SDL_VERSION_ATLEAST(X, Y, Z) \
+ (SDL_COMPILEDVERSION >= SDL_VERSIONNUM(X, Y, Z))
+
+/** This function gets the version of the dynamically linked SDL library.
+ * it should NOT be used to fill a version structure, instead you should
+ * use the SDL_Version() macro.
+ */
+extern DECLSPEC const SDL_version * SDLCALL SDL_Linked_Version(void);
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_version_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_video.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_video.h
new file mode 100644
index 000000000..8f7f30520
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/SDL_video.h
@@ -0,0 +1,951 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2.1 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Lesser General Public License for more details.
+
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/** @file SDL_video.h
+ * Header file for access to the SDL raw framebuffer window
+ */
+
+#ifndef _SDL_video_h
+#define _SDL_video_h
+
+#include "SDL_stdinc.h"
+#include "SDL_error.h"
+#include "SDL_rwops.h"
+
+#include "begin_code.h"
+/* Set up for C function definitions, even when using C++ */
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/** @name Transparency definitions
+ * These define alpha as the opacity of a surface
+ */
+/*@{*/
+#define SDL_ALPHA_OPAQUE 255
+#define SDL_ALPHA_TRANSPARENT 0
+/*@}*/
+
+/** @name Useful data types */
+/*@{*/
+typedef struct SDL_Rect {
+ Sint16 x, y;
+ Uint16 w, h;
+} SDL_Rect;
+
+typedef struct SDL_Color {
+ Uint8 r;
+ Uint8 g;
+ Uint8 b;
+ Uint8 unused;
+} SDL_Color;
+#define SDL_Colour SDL_Color
+
+typedef struct SDL_Palette {
+ int ncolors;
+ SDL_Color *colors;
+} SDL_Palette;
+/*@}*/
+
+/** Everything in the pixel format structure is read-only */
+typedef struct SDL_PixelFormat {
+ SDL_Palette *palette;
+ Uint8 BitsPerPixel;
+ Uint8 BytesPerPixel;
+ Uint8 Rloss;
+ Uint8 Gloss;
+ Uint8 Bloss;
+ Uint8 Aloss;
+ Uint8 Rshift;
+ Uint8 Gshift;
+ Uint8 Bshift;
+ Uint8 Ashift;
+ Uint32 Rmask;
+ Uint32 Gmask;
+ Uint32 Bmask;
+ Uint32 Amask;
+
+ /** RGB color key information */
+ Uint32 colorkey;
+ /** Alpha value information (per-surface alpha) */
+ Uint8 alpha;
+} SDL_PixelFormat;
+
+/** This structure should be treated as read-only, except for 'pixels',
+ * which, if not NULL, contains the raw pixel data for the surface.
+ */
+typedef struct SDL_Surface {
+ Uint32 flags; /**< Read-only */
+ SDL_PixelFormat *format; /**< Read-only */
+ int w, h; /**< Read-only */
+ Uint16 pitch; /**< Read-only */
+ void *pixels; /**< Read-write */
+ int offset; /**< Private */
+
+ /** Hardware-specific surface info */
+ struct private_hwdata *hwdata;
+
+ /** clipping information */
+ SDL_Rect clip_rect; /**< Read-only */
+ Uint32 unused1; /**< for binary compatibility */
+
+ /** Allow recursive locks */
+ Uint32 locked; /**< Private */
+
+ /** info for fast blit mapping to other surfaces */
+ struct SDL_BlitMap *map; /**< Private */
+
+ /** format version, bumped at every change to invalidate blit maps */
+ unsigned int format_version; /**< Private */
+
+ /** Reference count -- used when freeing surface */
+ int refcount; /**< Read-mostly */
+} SDL_Surface;
+
+/** @name SDL_Surface Flags
+ * These are the currently supported flags for the SDL_surface
+ */
+/*@{*/
+
+/** Available for SDL_CreateRGBSurface() or SDL_SetVideoMode() */
+/*@{*/
+#define SDL_SWSURFACE 0x00000000 /**< Surface is in system memory */
+#define SDL_HWSURFACE 0x00000001 /**< Surface is in video memory */
+#define SDL_ASYNCBLIT 0x00000004 /**< Use asynchronous blits if possible */
+/*@}*/
+
+/** Available for SDL_SetVideoMode() */
+/*@{*/
+#define SDL_ANYFORMAT 0x10000000 /**< Allow any video depth/pixel-format */
+#define SDL_HWPALETTE 0x20000000 /**< Surface has exclusive palette */
+#define SDL_DOUBLEBUF 0x40000000 /**< Set up double-buffered video mode */
+#define SDL_FULLSCREEN 0x80000000 /**< Surface is a full screen display */
+#define SDL_OPENGL 0x00000002 /**< Create an OpenGL rendering context */
+#define SDL_OPENGLBLIT 0x0000000A /**< Create an OpenGL rendering context and use it for blitting */
+#define SDL_RESIZABLE 0x00000010 /**< This video mode may be resized */
+#define SDL_NOFRAME 0x00000020 /**< No window caption or edge frame */
+/*@}*/
+
+/** Used internally (read-only) */
+/*@{*/
+#define SDL_HWACCEL 0x00000100 /**< Blit uses hardware acceleration */
+#define SDL_SRCCOLORKEY 0x00001000 /**< Blit uses a source color key */
+#define SDL_RLEACCELOK 0x00002000 /**< Private flag */
+#define SDL_RLEACCEL 0x00004000 /**< Surface is RLE encoded */
+#define SDL_SRCALPHA 0x00010000 /**< Blit uses source alpha blending */
+#define SDL_PREALLOC 0x01000000 /**< Surface uses preallocated memory */
+/*@}*/
+
+/*@}*/
+
+/** Evaluates to true if the surface needs to be locked before access */
+#define SDL_MUSTLOCK(surface) \
+ (surface->offset || \
+ ((surface->flags & (SDL_HWSURFACE|SDL_ASYNCBLIT|SDL_RLEACCEL)) != 0))
+
+/** typedef for private surface blitting functions */
+typedef int (*SDL_blit)(struct SDL_Surface *src, SDL_Rect *srcrect,
+ struct SDL_Surface *dst, SDL_Rect *dstrect);
+
+
+/** Useful for determining the video hardware capabilities */
+typedef struct SDL_VideoInfo {
+ Uint32 hw_available :1; /**< Flag: Can you create hardware surfaces? */
+ Uint32 wm_available :1; /**< Flag: Can you talk to a window manager? */
+ Uint32 UnusedBits1 :6;
+ Uint32 UnusedBits2 :1;
+ Uint32 blit_hw :1; /**< Flag: Accelerated blits HW --> HW */
+ Uint32 blit_hw_CC :1; /**< Flag: Accelerated blits with Colorkey */
+ Uint32 blit_hw_A :1; /**< Flag: Accelerated blits with Alpha */
+ Uint32 blit_sw :1; /**< Flag: Accelerated blits SW --> HW */
+ Uint32 blit_sw_CC :1; /**< Flag: Accelerated blits with Colorkey */
+ Uint32 blit_sw_A :1; /**< Flag: Accelerated blits with Alpha */
+ Uint32 blit_fill :1; /**< Flag: Accelerated color fill */
+ Uint32 UnusedBits3 :16;
+ Uint32 video_mem; /**< The total amount of video memory (in K) */
+ SDL_PixelFormat *vfmt; /**< Value: The format of the video surface */
+ int current_w; /**< Value: The current video mode width */
+ int current_h; /**< Value: The current video mode height */
+} SDL_VideoInfo;
+
+
+/** @name Overlay Formats
+ * The most common video overlay formats.
+ * For an explanation of these pixel formats, see:
+ * http://www.webartz.com/fourcc/indexyuv.htm
+ *
+ * For information on the relationship between color spaces, see:
+ * http://www.neuro.sfc.keio.ac.jp/~aly/polygon/info/color-space-faq.html
+ */
+/*@{*/
+#define SDL_YV12_OVERLAY 0x32315659 /**< Planar mode: Y + V + U (3 planes) */
+#define SDL_IYUV_OVERLAY 0x56555949 /**< Planar mode: Y + U + V (3 planes) */
+#define SDL_YUY2_OVERLAY 0x32595559 /**< Packed mode: Y0+U0+Y1+V0 (1 plane) */
+#define SDL_UYVY_OVERLAY 0x59565955 /**< Packed mode: U0+Y0+V0+Y1 (1 plane) */
+#define SDL_YVYU_OVERLAY 0x55595659 /**< Packed mode: Y0+V0+Y1+U0 (1 plane) */
+/*@}*/
+
+/** The YUV hardware video overlay */
+typedef struct SDL_Overlay {
+ Uint32 format; /**< Read-only */
+ int w, h; /**< Read-only */
+ int planes; /**< Read-only */
+ Uint16 *pitches; /**< Read-only */
+ Uint8 **pixels; /**< Read-write */
+
+ /** @name Hardware-specific surface info */
+ /*@{*/
+ struct private_yuvhwfuncs *hwfuncs;
+ struct private_yuvhwdata *hwdata;
+ /*@{*/
+
+ /** @name Special flags */
+ /*@{*/
+ Uint32 hw_overlay :1; /**< Flag: This overlay hardware accelerated? */
+ Uint32 UnusedBits :31;
+ /*@}*/
+} SDL_Overlay;
+
+
+/** Public enumeration for setting the OpenGL window attributes. */
+typedef enum {
+ SDL_GL_RED_SIZE,
+ SDL_GL_GREEN_SIZE,
+ SDL_GL_BLUE_SIZE,
+ SDL_GL_ALPHA_SIZE,
+ SDL_GL_BUFFER_SIZE,
+ SDL_GL_DOUBLEBUFFER,
+ SDL_GL_DEPTH_SIZE,
+ SDL_GL_STENCIL_SIZE,
+ SDL_GL_ACCUM_RED_SIZE,
+ SDL_GL_ACCUM_GREEN_SIZE,
+ SDL_GL_ACCUM_BLUE_SIZE,
+ SDL_GL_ACCUM_ALPHA_SIZE,
+ SDL_GL_STEREO,
+ SDL_GL_MULTISAMPLEBUFFERS,
+ SDL_GL_MULTISAMPLESAMPLES,
+ SDL_GL_ACCELERATED_VISUAL,
+ SDL_GL_SWAP_CONTROL
+} SDL_GLattr;
+
+/** @name flags for SDL_SetPalette() */
+/*@{*/
+#define SDL_LOGPAL 0x01
+#define SDL_PHYSPAL 0x02
+/*@}*/
+
+/* Function prototypes */
+
+/**
+ * @name Video Init and Quit
+ * These functions are used internally, and should not be used unless you
+ * have a specific need to specify the video driver you want to use.
+ * You should normally use SDL_Init() or SDL_InitSubSystem().
+ */
+/*@{*/
+/**
+ * Initializes the video subsystem. Sets up a connection
+ * to the window manager, etc, and determines the current video mode and
+ * pixel format, but does not initialize a window or graphics mode.
+ * Note that event handling is activated by this routine.
+ *
+ * If you use both sound and video in your application, you need to call
+ * SDL_Init() before opening the sound device, otherwise under Win32 DirectX,
+ * you won't be able to set full-screen display modes.
+ */
+extern DECLSPEC int SDLCALL SDL_VideoInit(const char *driver_name, Uint32 flags);
+extern DECLSPEC void SDLCALL SDL_VideoQuit(void);
+/*@}*/
+
+/**
+ * This function fills the given character buffer with the name of the
+ * video driver, and returns a pointer to it if the video driver has
+ * been initialized. It returns NULL if no driver has been initialized.
+ */
+extern DECLSPEC char * SDLCALL SDL_VideoDriverName(char *namebuf, int maxlen);
+
+/**
+ * This function returns a pointer to the current display surface.
+ * If SDL is doing format conversion on the display surface, this
+ * function returns the publicly visible surface, not the real video
+ * surface.
+ */
+extern DECLSPEC SDL_Surface * SDLCALL SDL_GetVideoSurface(void);
+
+/**
+ * This function returns a read-only pointer to information about the
+ * video hardware. If this is called before SDL_SetVideoMode(), the 'vfmt'
+ * member of the returned structure will contain the pixel format of the
+ * "best" video mode.
+ */
+extern DECLSPEC const SDL_VideoInfo * SDLCALL SDL_GetVideoInfo(void);
+
+/**
+ * Check to see if a particular video mode is supported.
+ * It returns 0 if the requested mode is not supported under any bit depth,
+ * or returns the bits-per-pixel of the closest available mode with the
+ * given width and height. If this bits-per-pixel is different from the
+ * one used when setting the video mode, SDL_SetVideoMode() will succeed,
+ * but will emulate the requested bits-per-pixel with a shadow surface.
+ *
+ * The arguments to SDL_VideoModeOK() are the same ones you would pass to
+ * SDL_SetVideoMode()
+ */
+extern DECLSPEC int SDLCALL SDL_VideoModeOK(int width, int height, int bpp, Uint32 flags);
+
+/**
+ * Return a pointer to an array of available screen dimensions for the
+ * given format and video flags, sorted largest to smallest. Returns
+ * NULL if there are no dimensions available for a particular format,
+ * or (SDL_Rect **)-1 if any dimension is okay for the given format.
+ *
+ * If 'format' is NULL, the mode list will be for the format given
+ * by SDL_GetVideoInfo()->vfmt
+ */
+extern DECLSPEC SDL_Rect ** SDLCALL SDL_ListModes(SDL_PixelFormat *format, Uint32 flags);
+
+/**
+ * Set up a video mode with the specified width, height and bits-per-pixel.
+ *
+ * If 'bpp' is 0, it is treated as the current display bits per pixel.
+ *
+ * If SDL_ANYFORMAT is set in 'flags', the SDL library will try to set the
+ * requested bits-per-pixel, but will return whatever video pixel format is
+ * available. The default is to emulate the requested pixel format if it
+ * is not natively available.
+ *
+ * If SDL_HWSURFACE is set in 'flags', the video surface will be placed in
+ * video memory, if possible, and you may have to call SDL_LockSurface()
+ * in order to access the raw framebuffer. Otherwise, the video surface
+ * will be created in system memory.
+ *
+ * If SDL_ASYNCBLIT is set in 'flags', SDL will try to perform rectangle
+ * updates asynchronously, but you must always lock before accessing pixels.
+ * SDL will wait for updates to complete before returning from the lock.
+ *
+ * If SDL_HWPALETTE is set in 'flags', the SDL library will guarantee
+ * that the colors set by SDL_SetColors() will be the colors you get.
+ * Otherwise, in 8-bit mode, SDL_SetColors() may not be able to set all
+ * of the colors exactly the way they are requested, and you should look
+ * at the video surface structure to determine the actual palette.
+ * If SDL cannot guarantee that the colors you request can be set,
+ * i.e. if the colormap is shared, then the video surface may be created
+ * under emulation in system memory, overriding the SDL_HWSURFACE flag.
+ *
+ * If SDL_FULLSCREEN is set in 'flags', the SDL library will try to set
+ * a fullscreen video mode. The default is to create a windowed mode
+ * if the current graphics system has a window manager.
+ * If the SDL library is able to set a fullscreen video mode, this flag
+ * will be set in the surface that is returned.
+ *
+ * If SDL_DOUBLEBUF is set in 'flags', the SDL library will try to set up
+ * two surfaces in video memory and swap between them when you call
+ * SDL_Flip(). This is usually slower than the normal single-buffering
+ * scheme, but prevents "tearing" artifacts caused by modifying video
+ * memory while the monitor is refreshing. It should only be used by
+ * applications that redraw the entire screen on every update.
+ *
+ * If SDL_RESIZABLE is set in 'flags', the SDL library will allow the
+ * window manager, if any, to resize the window at runtime. When this
+ * occurs, SDL will send a SDL_VIDEORESIZE event to you application,
+ * and you must respond to the event by re-calling SDL_SetVideoMode()
+ * with the requested size (or another size that suits the application).
+ *
+ * If SDL_NOFRAME is set in 'flags', the SDL library will create a window
+ * without any title bar or frame decoration. Fullscreen video modes have
+ * this flag set automatically.
+ *
+ * This function returns the video framebuffer surface, or NULL if it fails.
+ *
+ * If you rely on functionality provided by certain video flags, check the
+ * flags of the returned surface to make sure that functionality is available.
+ * SDL will fall back to reduced functionality if the exact flags you wanted
+ * are not available.
+ */
+extern DECLSPEC SDL_Surface * SDLCALL SDL_SetVideoMode
+ (int width, int height, int bpp, Uint32 flags);
+
+/** @name SDL_Update Functions
+ * These functions should not be called while 'screen' is locked.
+ */
+/*@{*/
+/**
+ * Makes sure the given list of rectangles is updated on the given screen.
+ */
+extern DECLSPEC void SDLCALL SDL_UpdateRects
+ (SDL_Surface *screen, int numrects, SDL_Rect *rects);
+/**
+ * If 'x', 'y', 'w' and 'h' are all 0, SDL_UpdateRect will update the entire
+ * screen.
+ */
+extern DECLSPEC void SDLCALL SDL_UpdateRect
+ (SDL_Surface *screen, Sint32 x, Sint32 y, Uint32 w, Uint32 h);
+/*@}*/
+
+/**
+ * On hardware that supports double-buffering, this function sets up a flip
+ * and returns. The hardware will wait for vertical retrace, and then swap
+ * video buffers before the next video surface blit or lock will return.
+ * On hardware that doesn not support double-buffering, this is equivalent
+ * to calling SDL_UpdateRect(screen, 0, 0, 0, 0);
+ * The SDL_DOUBLEBUF flag must have been passed to SDL_SetVideoMode() when
+ * setting the video mode for this function to perform hardware flipping.
+ * This function returns 0 if successful, or -1 if there was an error.
+ */
+extern DECLSPEC int SDLCALL SDL_Flip(SDL_Surface *screen);
+
+/**
+ * Set the gamma correction for each of the color channels.
+ * The gamma values range (approximately) between 0.1 and 10.0
+ *
+ * If this function isn't supported directly by the hardware, it will
+ * be emulated using gamma ramps, if available. If successful, this
+ * function returns 0, otherwise it returns -1.
+ */
+extern DECLSPEC int SDLCALL SDL_SetGamma(float red, float green, float blue);
+
+/**
+ * Set the gamma translation table for the red, green, and blue channels
+ * of the video hardware. Each table is an array of 256 16-bit quantities,
+ * representing a mapping between the input and output for that channel.
+ * The input is the index into the array, and the output is the 16-bit
+ * gamma value at that index, scaled to the output color precision.
+ *
+ * You may pass NULL for any of the channels to leave it unchanged.
+ * If the call succeeds, it will return 0. If the display driver or
+ * hardware does not support gamma translation, or otherwise fails,
+ * this function will return -1.
+ */
+extern DECLSPEC int SDLCALL SDL_SetGammaRamp(const Uint16 *red, const Uint16 *green, const Uint16 *blue);
+
+/**
+ * Retrieve the current values of the gamma translation tables.
+ *
+ * You must pass in valid pointers to arrays of 256 16-bit quantities.
+ * Any of the pointers may be NULL to ignore that channel.
+ * If the call succeeds, it will return 0. If the display driver or
+ * hardware does not support gamma translation, or otherwise fails,
+ * this function will return -1.
+ */
+extern DECLSPEC int SDLCALL SDL_GetGammaRamp(Uint16 *red, Uint16 *green, Uint16 *blue);
+
+/**
+ * Sets a portion of the colormap for the given 8-bit surface. If 'surface'
+ * is not a palettized surface, this function does nothing, returning 0.
+ * If all of the colors were set as passed to SDL_SetColors(), it will
+ * return 1. If not all the color entries were set exactly as given,
+ * it will return 0, and you should look at the surface palette to
+ * determine the actual color palette.
+ *
+ * When 'surface' is the surface associated with the current display, the
+ * display colormap will be updated with the requested colors. If
+ * SDL_HWPALETTE was set in SDL_SetVideoMode() flags, SDL_SetColors()
+ * will always return 1, and the palette is guaranteed to be set the way
+ * you desire, even if the window colormap has to be warped or run under
+ * emulation.
+ */
+extern DECLSPEC int SDLCALL SDL_SetColors(SDL_Surface *surface,
+ SDL_Color *colors, int firstcolor, int ncolors);
+
+/**
+ * Sets a portion of the colormap for a given 8-bit surface.
+ * 'flags' is one or both of:
+ * SDL_LOGPAL -- set logical palette, which controls how blits are mapped
+ * to/from the surface,
+ * SDL_PHYSPAL -- set physical palette, which controls how pixels look on
+ * the screen
+ * Only screens have physical palettes. Separate change of physical/logical
+ * palettes is only possible if the screen has SDL_HWPALETTE set.
+ *
+ * The return value is 1 if all colours could be set as requested, and 0
+ * otherwise.
+ *
+ * SDL_SetColors() is equivalent to calling this function with
+ * flags = (SDL_LOGPAL|SDL_PHYSPAL).
+ */
+extern DECLSPEC int SDLCALL SDL_SetPalette(SDL_Surface *surface, int flags,
+ SDL_Color *colors, int firstcolor,
+ int ncolors);
+
+/**
+ * Maps an RGB triple to an opaque pixel value for a given pixel format
+ */
+extern DECLSPEC Uint32 SDLCALL SDL_MapRGB
+(const SDL_PixelFormat * const format,
+ const Uint8 r, const Uint8 g, const Uint8 b);
+
+/**
+ * Maps an RGBA quadruple to a pixel value for a given pixel format
+ */
+extern DECLSPEC Uint32 SDLCALL SDL_MapRGBA
+(const SDL_PixelFormat * const format,
+ const Uint8 r, const Uint8 g, const Uint8 b, const Uint8 a);
+
+/**
+ * Maps a pixel value into the RGB components for a given pixel format
+ */
+extern DECLSPEC void SDLCALL SDL_GetRGB(Uint32 pixel,
+ const SDL_PixelFormat * const fmt,
+ Uint8 *r, Uint8 *g, Uint8 *b);
+
+/**
+ * Maps a pixel value into the RGBA components for a given pixel format
+ */
+extern DECLSPEC void SDLCALL SDL_GetRGBA(Uint32 pixel,
+ const SDL_PixelFormat * const fmt,
+ Uint8 *r, Uint8 *g, Uint8 *b, Uint8 *a);
+
+/** @sa SDL_CreateRGBSurface */
+#define SDL_AllocSurface SDL_CreateRGBSurface
+/**
+ * Allocate and free an RGB surface (must be called after SDL_SetVideoMode)
+ * If the depth is 4 or 8 bits, an empty palette is allocated for the surface.
+ * If the depth is greater than 8 bits, the pixel format is set using the
+ * flags '[RGB]mask'.
+ * If the function runs out of memory, it will return NULL.
+ *
+ * The 'flags' tell what kind of surface to create.
+ * SDL_SWSURFACE means that the surface should be created in system memory.
+ * SDL_HWSURFACE means that the surface should be created in video memory,
+ * with the same format as the display surface. This is useful for surfaces
+ * that will not change much, to take advantage of hardware acceleration
+ * when being blitted to the display surface.
+ * SDL_ASYNCBLIT means that SDL will try to perform asynchronous blits with
+ * this surface, but you must always lock it before accessing the pixels.
+ * SDL will wait for current blits to finish before returning from the lock.
+ * SDL_SRCCOLORKEY indicates that the surface will be used for colorkey blits.
+ * If the hardware supports acceleration of colorkey blits between
+ * two surfaces in video memory, SDL will try to place the surface in
+ * video memory. If this isn't possible or if there is no hardware
+ * acceleration available, the surface will be placed in system memory.
+ * SDL_SRCALPHA means that the surface will be used for alpha blits and
+ * if the hardware supports hardware acceleration of alpha blits between
+ * two surfaces in video memory, to place the surface in video memory
+ * if possible, otherwise it will be placed in system memory.
+ * If the surface is created in video memory, blits will be _much_ faster,
+ * but the surface format must be identical to the video surface format,
+ * and the only way to access the pixels member of the surface is to use
+ * the SDL_LockSurface() and SDL_UnlockSurface() calls.
+ * If the requested surface actually resides in video memory, SDL_HWSURFACE
+ * will be set in the flags member of the returned surface. If for some
+ * reason the surface could not be placed in video memory, it will not have
+ * the SDL_HWSURFACE flag set, and will be created in system memory instead.
+ */
+extern DECLSPEC SDL_Surface * SDLCALL SDL_CreateRGBSurface
+ (Uint32 flags, int width, int height, int depth,
+ Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask);
+/** @sa SDL_CreateRGBSurface */
+extern DECLSPEC SDL_Surface * SDLCALL SDL_CreateRGBSurfaceFrom(void *pixels,
+ int width, int height, int depth, int pitch,
+ Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask);
+extern DECLSPEC void SDLCALL SDL_FreeSurface(SDL_Surface *surface);
+
+/**
+ * SDL_LockSurface() sets up a surface for directly accessing the pixels.
+ * Between calls to SDL_LockSurface()/SDL_UnlockSurface(), you can write
+ * to and read from 'surface->pixels', using the pixel format stored in
+ * 'surface->format'. Once you are done accessing the surface, you should
+ * use SDL_UnlockSurface() to release it.
+ *
+ * Not all surfaces require locking. If SDL_MUSTLOCK(surface) evaluates
+ * to 0, then you can read and write to the surface at any time, and the
+ * pixel format of the surface will not change. In particular, if the
+ * SDL_HWSURFACE flag is not given when calling SDL_SetVideoMode(), you
+ * will not need to lock the display surface before accessing it.
+ *
+ * No operating system or library calls should be made between lock/unlock
+ * pairs, as critical system locks may be held during this time.
+ *
+ * SDL_LockSurface() returns 0, or -1 if the surface couldn't be locked.
+ */
+extern DECLSPEC int SDLCALL SDL_LockSurface(SDL_Surface *surface);
+extern DECLSPEC void SDLCALL SDL_UnlockSurface(SDL_Surface *surface);
+
+/**
+ * Load a surface from a seekable SDL data source (memory or file.)
+ * If 'freesrc' is non-zero, the source will be closed after being read.
+ * Returns the new surface, or NULL if there was an error.
+ * The new surface should be freed with SDL_FreeSurface().
+ */
+extern DECLSPEC SDL_Surface * SDLCALL SDL_LoadBMP_RW(SDL_RWops *src, int freesrc);
+
+/** Convenience macro -- load a surface from a file */
+#define SDL_LoadBMP(file) SDL_LoadBMP_RW(SDL_RWFromFile(file, "rb"), 1)
+
+/**
+ * Save a surface to a seekable SDL data source (memory or file.)
+ * If 'freedst' is non-zero, the source will be closed after being written.
+ * Returns 0 if successful or -1 if there was an error.
+ */
+extern DECLSPEC int SDLCALL SDL_SaveBMP_RW
+ (SDL_Surface *surface, SDL_RWops *dst, int freedst);
+
+/** Convenience macro -- save a surface to a file */
+#define SDL_SaveBMP(surface, file) \
+ SDL_SaveBMP_RW(surface, SDL_RWFromFile(file, "wb"), 1)
+
+/**
+ * Sets the color key (transparent pixel) in a blittable surface.
+ * If 'flag' is SDL_SRCCOLORKEY (optionally OR'd with SDL_RLEACCEL),
+ * 'key' will be the transparent pixel in the source image of a blit.
+ * SDL_RLEACCEL requests RLE acceleration for the surface if present,
+ * and removes RLE acceleration if absent.
+ * If 'flag' is 0, this function clears any current color key.
+ * This function returns 0, or -1 if there was an error.
+ */
+extern DECLSPEC int SDLCALL SDL_SetColorKey
+ (SDL_Surface *surface, Uint32 flag, Uint32 key);
+
+/**
+ * This function sets the alpha value for the entire surface, as opposed to
+ * using the alpha component of each pixel. This value measures the range
+ * of transparency of the surface, 0 being completely transparent to 255
+ * being completely opaque. An 'alpha' value of 255 causes blits to be
+ * opaque, the source pixels copied to the destination (the default). Note
+ * that per-surface alpha can be combined with colorkey transparency.
+ *
+ * If 'flag' is 0, alpha blending is disabled for the surface.
+ * If 'flag' is SDL_SRCALPHA, alpha blending is enabled for the surface.
+ * OR:ing the flag with SDL_RLEACCEL requests RLE acceleration for the
+ * surface; if SDL_RLEACCEL is not specified, the RLE accel will be removed.
+ *
+ * The 'alpha' parameter is ignored for surfaces that have an alpha channel.
+ */
+extern DECLSPEC int SDLCALL SDL_SetAlpha(SDL_Surface *surface, Uint32 flag, Uint8 alpha);
+
+/**
+ * Sets the clipping rectangle for the destination surface in a blit.
+ *
+ * If the clip rectangle is NULL, clipping will be disabled.
+ * If the clip rectangle doesn't intersect the surface, the function will
+ * return SDL_FALSE and blits will be completely clipped. Otherwise the
+ * function returns SDL_TRUE and blits to the surface will be clipped to
+ * the intersection of the surface area and the clipping rectangle.
+ *
+ * Note that blits are automatically clipped to the edges of the source
+ * and destination surfaces.
+ */
+extern DECLSPEC SDL_bool SDLCALL SDL_SetClipRect(SDL_Surface *surface, const SDL_Rect *rect);
+
+/**
+ * Gets the clipping rectangle for the destination surface in a blit.
+ * 'rect' must be a pointer to a valid rectangle which will be filled
+ * with the correct values.
+ */
+extern DECLSPEC void SDLCALL SDL_GetClipRect(SDL_Surface *surface, SDL_Rect *rect);
+
+/**
+ * Creates a new surface of the specified format, and then copies and maps
+ * the given surface to it so the blit of the converted surface will be as
+ * fast as possible. If this function fails, it returns NULL.
+ *
+ * The 'flags' parameter is passed to SDL_CreateRGBSurface() and has those
+ * semantics. You can also pass SDL_RLEACCEL in the flags parameter and
+ * SDL will try to RLE accelerate colorkey and alpha blits in the resulting
+ * surface.
+ *
+ * This function is used internally by SDL_DisplayFormat().
+ */
+extern DECLSPEC SDL_Surface * SDLCALL SDL_ConvertSurface
+ (SDL_Surface *src, SDL_PixelFormat *fmt, Uint32 flags);
+
+/**
+ * This performs a fast blit from the source surface to the destination
+ * surface. It assumes that the source and destination rectangles are
+ * the same size. If either 'srcrect' or 'dstrect' are NULL, the entire
+ * surface (src or dst) is copied. The final blit rectangles are saved
+ * in 'srcrect' and 'dstrect' after all clipping is performed.
+ * If the blit is successful, it returns 0, otherwise it returns -1.
+ *
+ * The blit function should not be called on a locked surface.
+ *
+ * The blit semantics for surfaces with and without alpha and colorkey
+ * are defined as follows:
+ *
+ * RGBA->RGB:
+ * SDL_SRCALPHA set:
+ * alpha-blend (using alpha-channel).
+ * SDL_SRCCOLORKEY ignored.
+ * SDL_SRCALPHA not set:
+ * copy RGB.
+ * if SDL_SRCCOLORKEY set, only copy the pixels matching the
+ * RGB values of the source colour key, ignoring alpha in the
+ * comparison.
+ *
+ * RGB->RGBA:
+ * SDL_SRCALPHA set:
+ * alpha-blend (using the source per-surface alpha value);
+ * set destination alpha to opaque.
+ * SDL_SRCALPHA not set:
+ * copy RGB, set destination alpha to source per-surface alpha value.
+ * both:
+ * if SDL_SRCCOLORKEY set, only copy the pixels matching the
+ * source colour key.
+ *
+ * RGBA->RGBA:
+ * SDL_SRCALPHA set:
+ * alpha-blend (using the source alpha channel) the RGB values;
+ * leave destination alpha untouched. [Note: is this correct?]
+ * SDL_SRCCOLORKEY ignored.
+ * SDL_SRCALPHA not set:
+ * copy all of RGBA to the destination.
+ * if SDL_SRCCOLORKEY set, only copy the pixels matching the
+ * RGB values of the source colour key, ignoring alpha in the
+ * comparison.
+ *
+ * RGB->RGB:
+ * SDL_SRCALPHA set:
+ * alpha-blend (using the source per-surface alpha value).
+ * SDL_SRCALPHA not set:
+ * copy RGB.
+ * both:
+ * if SDL_SRCCOLORKEY set, only copy the pixels matching the
+ * source colour key.
+ *
+ * If either of the surfaces were in video memory, and the blit returns -2,
+ * the video memory was lost, so it should be reloaded with artwork and
+ * re-blitted:
+ * @code
+ * while ( SDL_BlitSurface(image, imgrect, screen, dstrect) == -2 ) {
+ * while ( SDL_LockSurface(image) < 0 )
+ * Sleep(10);
+ * -- Write image pixels to image->pixels --
+ * SDL_UnlockSurface(image);
+ * }
+ * @endcode
+ *
+ * This happens under DirectX 5.0 when the system switches away from your
+ * fullscreen application. The lock will also fail until you have access
+ * to the video memory again.
+ *
+ * You should call SDL_BlitSurface() unless you know exactly how SDL
+ * blitting works internally and how to use the other blit functions.
+ */
+#define SDL_BlitSurface SDL_UpperBlit
+
+/** This is the public blit function, SDL_BlitSurface(), and it performs
+ * rectangle validation and clipping before passing it to SDL_LowerBlit()
+ */
+extern DECLSPEC int SDLCALL SDL_UpperBlit
+ (SDL_Surface *src, SDL_Rect *srcrect,
+ SDL_Surface *dst, SDL_Rect *dstrect);
+/** This is a semi-private blit function and it performs low-level surface
+ * blitting only.
+ */
+extern DECLSPEC int SDLCALL SDL_LowerBlit
+ (SDL_Surface *src, SDL_Rect *srcrect,
+ SDL_Surface *dst, SDL_Rect *dstrect);
+
+/**
+ * This function performs a fast fill of the given rectangle with 'color'
+ * The given rectangle is clipped to the destination surface clip area
+ * and the final fill rectangle is saved in the passed in pointer.
+ * If 'dstrect' is NULL, the whole surface will be filled with 'color'
+ * The color should be a pixel of the format used by the surface, and
+ * can be generated by the SDL_MapRGB() function.
+ * This function returns 0 on success, or -1 on error.
+ */
+extern DECLSPEC int SDLCALL SDL_FillRect
+ (SDL_Surface *dst, SDL_Rect *dstrect, Uint32 color);
+
+/**
+ * This function takes a surface and copies it to a new surface of the
+ * pixel format and colors of the video framebuffer, suitable for fast
+ * blitting onto the display surface. It calls SDL_ConvertSurface()
+ *
+ * If you want to take advantage of hardware colorkey or alpha blit
+ * acceleration, you should set the colorkey and alpha value before
+ * calling this function.
+ *
+ * If the conversion fails or runs out of memory, it returns NULL
+ */
+extern DECLSPEC SDL_Surface * SDLCALL SDL_DisplayFormat(SDL_Surface *surface);
+
+/**
+ * This function takes a surface and copies it to a new surface of the
+ * pixel format and colors of the video framebuffer (if possible),
+ * suitable for fast alpha blitting onto the display surface.
+ * The new surface will always have an alpha channel.
+ *
+ * If you want to take advantage of hardware colorkey or alpha blit
+ * acceleration, you should set the colorkey and alpha value before
+ * calling this function.
+ *
+ * If the conversion fails or runs out of memory, it returns NULL
+ */
+extern DECLSPEC SDL_Surface * SDLCALL SDL_DisplayFormatAlpha(SDL_Surface *surface);
+
+
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+/** @name YUV video surface overlay functions */ /*@{*/
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+
+/** This function creates a video output overlay
+ * Calling the returned surface an overlay is something of a misnomer because
+ * the contents of the display surface underneath the area where the overlay
+ * is shown is undefined - it may be overwritten with the converted YUV data.
+ */
+extern DECLSPEC SDL_Overlay * SDLCALL SDL_CreateYUVOverlay(int width, int height,
+ Uint32 format, SDL_Surface *display);
+
+/** Lock an overlay for direct access, and unlock it when you are done */
+extern DECLSPEC int SDLCALL SDL_LockYUVOverlay(SDL_Overlay *overlay);
+extern DECLSPEC void SDLCALL SDL_UnlockYUVOverlay(SDL_Overlay *overlay);
+
+/** Blit a video overlay to the display surface.
+ * The contents of the video surface underneath the blit destination are
+ * not defined.
+ * The width and height of the destination rectangle may be different from
+ * that of the overlay, but currently only 2x scaling is supported.
+ */
+extern DECLSPEC int SDLCALL SDL_DisplayYUVOverlay(SDL_Overlay *overlay, SDL_Rect *dstrect);
+
+/** Free a video overlay */
+extern DECLSPEC void SDLCALL SDL_FreeYUVOverlay(SDL_Overlay *overlay);
+
+/*@}*/
+
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+/** @name OpenGL support functions. */ /*@{*/
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+
+/**
+ * Dynamically load an OpenGL library, or the default one if path is NULL
+ *
+ * If you do this, you need to retrieve all of the GL functions used in
+ * your program from the dynamic library using SDL_GL_GetProcAddress().
+ */
+extern DECLSPEC int SDLCALL SDL_GL_LoadLibrary(const char *path);
+
+/**
+ * Get the address of a GL function
+ */
+extern DECLSPEC void * SDLCALL SDL_GL_GetProcAddress(const char* proc);
+
+/**
+ * Set an attribute of the OpenGL subsystem before intialization.
+ */
+extern DECLSPEC int SDLCALL SDL_GL_SetAttribute(SDL_GLattr attr, int value);
+
+/**
+ * Get an attribute of the OpenGL subsystem from the windowing
+ * interface, such as glX. This is of course different from getting
+ * the values from SDL's internal OpenGL subsystem, which only
+ * stores the values you request before initialization.
+ *
+ * Developers should track the values they pass into SDL_GL_SetAttribute
+ * themselves if they want to retrieve these values.
+ */
+extern DECLSPEC int SDLCALL SDL_GL_GetAttribute(SDL_GLattr attr, int* value);
+
+/**
+ * Swap the OpenGL buffers, if double-buffering is supported.
+ */
+extern DECLSPEC void SDLCALL SDL_GL_SwapBuffers(void);
+
+/** @name OpenGL Internal Functions
+ * Internal functions that should not be called unless you have read
+ * and understood the source code for these functions.
+ */
+/*@{*/
+extern DECLSPEC void SDLCALL SDL_GL_UpdateRects(int numrects, SDL_Rect* rects);
+extern DECLSPEC void SDLCALL SDL_GL_Lock(void);
+extern DECLSPEC void SDLCALL SDL_GL_Unlock(void);
+/*@}*/
+
+/*@}*/
+
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+/** @name Window Manager Functions */
+/** These functions allow interaction with the window manager, if any. */ /*@{*/
+/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
+
+/**
+ * Sets the title and icon text of the display window (UTF-8 encoded)
+ */
+extern DECLSPEC void SDLCALL SDL_WM_SetCaption(const char *title, const char *icon);
+/**
+ * Gets the title and icon text of the display window (UTF-8 encoded)
+ */
+extern DECLSPEC void SDLCALL SDL_WM_GetCaption(char **title, char **icon);
+
+/**
+ * Sets the icon for the display window.
+ * This function must be called before the first call to SDL_SetVideoMode().
+ * It takes an icon surface, and a mask in MSB format.
+ * If 'mask' is NULL, the entire icon surface will be used as the icon.
+ */
+extern DECLSPEC void SDLCALL SDL_WM_SetIcon(SDL_Surface *icon, Uint8 *mask);
+
+/**
+ * This function iconifies the window, and returns 1 if it succeeded.
+ * If the function succeeds, it generates an SDL_APPACTIVE loss event.
+ * This function is a noop and returns 0 in non-windowed environments.
+ */
+extern DECLSPEC int SDLCALL SDL_WM_IconifyWindow(void);
+
+/**
+ * Toggle fullscreen mode without changing the contents of the screen.
+ * If the display surface does not require locking before accessing
+ * the pixel information, then the memory pointers will not change.
+ *
+ * If this function was able to toggle fullscreen mode (change from
+ * running in a window to fullscreen, or vice-versa), it will return 1.
+ * If it is not implemented, or fails, it returns 0.
+ *
+ * The next call to SDL_SetVideoMode() will set the mode fullscreen
+ * attribute based on the flags parameter - if SDL_FULLSCREEN is not
+ * set, then the display will be windowed by default where supported.
+ *
+ * This is currently only implemented in the X11 video driver.
+ */
+extern DECLSPEC int SDLCALL SDL_WM_ToggleFullScreen(SDL_Surface *surface);
+
+typedef enum {
+ SDL_GRAB_QUERY = -1,
+ SDL_GRAB_OFF = 0,
+ SDL_GRAB_ON = 1,
+ SDL_GRAB_FULLSCREEN /**< Used internally */
+} SDL_GrabMode;
+/**
+ * This function allows you to set and query the input grab state of
+ * the application. It returns the new input grab state.
+ *
+ * Grabbing means that the mouse is confined to the application window,
+ * and nearly all keyboard input is passed directly to the application,
+ * and not interpreted by a window manager, if any.
+ */
+extern DECLSPEC SDL_GrabMode SDLCALL SDL_WM_GrabInput(SDL_GrabMode mode);
+
+/*@}*/
+
+/** @internal Not in public API at the moment - do not use! */
+extern DECLSPEC int SDLCALL SDL_SoftStretch(SDL_Surface *src, SDL_Rect *srcrect,
+ SDL_Surface *dst, SDL_Rect *dstrect);
+
+/* Ends C function definitions when using C++ */
+#ifdef __cplusplus
+}
+#endif
+#include "close_code.h"
+
+#endif /* _SDL_video_h */
diff --git a/dep/recastnavigation/RecastDemo/Contrib/SDL/include/begin_code.h b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/begin_code.h
new file mode 100644
index 000000000..22748090c
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/SDL/include/begin_code.h
@@ -0,0 +1,191 @@
+/*
+ SDL - Simple DirectMedia Layer
+ Copyright (C) 1997-2009 Sam Lantinga
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Library General Public
+ License as published by the Free Software Foundation; either
+ version 2 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Library General Public License for more details.
+
+ You should have received a copy of the GNU Library General Public
+ License along with this library; if not, write to the Free
+ Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
+
+ Sam Lantinga
+ slouken@libsdl.org
+*/
+
+/**
+ * @file begin_code.h
+ * This file sets things up for C dynamic library function definitions,
+ * static inlined functions, and structures aligned at 4-byte alignment.
+ * If you don't like ugly C preprocessor code, don't look at this file. :)
+ */
+
+/**
+ * @file begin_code.h
+ * This shouldn't be nested -- included it around code only.
+ */
+#ifdef _begin_code_h
+#error Nested inclusion of begin_code.h
+#endif
+#define _begin_code_h
+
+/**
+ * @def DECLSPEC
+ * Some compilers use a special export keyword
+ */
+#ifndef DECLSPEC
+# if defined(__BEOS__) || defined(__HAIKU__)
+# if defined(__GNUC__)
+# define DECLSPEC __declspec(dllexport)
+# else
+# define DECLSPEC __declspec(export)
+# endif
+# elif defined(__WIN32__)
+# ifdef __BORLANDC__
+# ifdef BUILD_SDL
+# define DECLSPEC
+# else
+# define DECLSPEC __declspec(dllimport)
+# endif
+# else
+# define DECLSPEC __declspec(dllexport)
+# endif
+# elif defined(__OS2__)
+# ifdef __WATCOMC__
+# ifdef BUILD_SDL
+# define DECLSPEC __declspec(dllexport)
+# else
+# define DECLSPEC
+# endif
+# elif defined (__GNUC__) && __GNUC__ < 4
+# /* Added support for GCC-EMX = 4
+# define DECLSPEC __attribute__ ((visibility("default")))
+# else
+# define DECLSPEC
+# endif
+# endif
+#endif
+
+/**
+ * @def SDLCALL
+ * By default SDL uses the C calling convention
+ */
+#ifndef SDLCALL
+# if defined(__WIN32__) && !defined(__GNUC__)
+# define SDLCALL __cdecl
+# elif defined(__OS2__)
+# if defined (__GNUC__) && __GNUC__ < 4
+# /* Added support for GCC-EMX 9 bits but less
+ than 16 available
+ 0.56 fix bug: zlib uncompressed mode len vs. nlen
+ 0.55 fix bug: restart_interval not initialized to 0
+ 0.54 allow NULL for 'int *comp'
+ 0.53 fix bug in png 3->4; speedup png decoding
+ 0.52 png handles req_comp=3,4 directly; minor cleanup; jpeg comments
+ 0.51 obey req_comp requests, 1-component jpegs return as 1-component,
+ on 'test' only check type, not whether we support this variant
+*/
+
+
+#ifndef STBI_INCLUDE_STB_IMAGE_H
+#define STBI_INCLUDE_STB_IMAGE_H
+
+//// begin header file ////////////////////////////////////////////////////
+//
+// Limitations:
+// - no progressive/interlaced support (jpeg, png)
+// - 8-bit samples only (jpeg, png)
+// - not threadsafe
+// - channel subsampling of at most 2 in each dimension (jpeg)
+// - no delayed line count (jpeg) -- IJG doesn't support either
+//
+// Basic usage (see HDR discussion below):
+// int x,y,n;
+// unsigned char *data = stbi_load(filename, &x, &y, &n, 0);
+// // ... process data if not NULL ...
+// // ... x = width, y = height, n = # 8-bit components per pixel ...
+// // ... replace '0' with '1'..'4' to force that many components per pixel
+// stbi_image_free(data)
+//
+// Standard parameters:
+// int *x -- outputs image width in pixels
+// int *y -- outputs image height in pixels
+// int *comp -- outputs # of image components in image file
+// int req_comp -- if non-zero, # of image components requested in result
+//
+// The return value from an image loader is an 'unsigned char *' which points
+// to the pixel data. The pixel data consists of *y scanlines of *x pixels,
+// with each pixel consisting of N interleaved 8-bit components; the first
+// pixel pointed to is top-left-most in the image. There is no padding between
+// image scanlines or between pixels, regardless of format. The number of
+// components N is 'req_comp' if req_comp is non-zero, or *comp otherwise.
+// If req_comp is non-zero, *comp has the number of components that _would_
+// have been output otherwise. E.g. if you set req_comp to 4, you will always
+// get RGBA output, but you can check *comp to easily see if it's opaque.
+//
+// An output image with N components has the following components interleaved
+// in this order in each pixel:
+//
+// N=#comp components
+// 1 grey
+// 2 grey, alpha
+// 3 red, green, blue
+// 4 red, green, blue, alpha
+//
+// If image loading fails for any reason, the return value will be NULL,
+// and *x, *y, *comp will be unchanged. The function stbi_failure_reason()
+// can be queried for an extremely brief, end-user unfriendly explanation
+// of why the load failed. Define STBI_NO_FAILURE_STRINGS to avoid
+// compiling these strings at all, and STBI_FAILURE_USERMSG to get slightly
+// more user-friendly ones.
+//
+// Paletted PNG and BMP images are automatically depalettized.
+//
+//
+// ===========================================================================
+//
+// HDR image support (disable by defining STBI_NO_HDR)
+//
+// stb_image now supports loading HDR images in general, and currently
+// the Radiance .HDR file format, although the support is provided
+// generically. You can still load any file through the existing interface;
+// if you attempt to load an HDR file, it will be automatically remapped to
+// LDR, assuming gamma 2.2 and an arbitrary scale factor defaulting to 1;
+// both of these constants can be reconfigured through this interface:
+//
+// stbi_hdr_to_ldr_gamma(2.2f);
+// stbi_hdr_to_ldr_scale(1.0f);
+//
+// (note, do not use _inverse_ constants; stbi_image will invert them
+// appropriately).
+//
+// Additionally, there is a new, parallel interface for loading files as
+// (linear) floats to preserve the full dynamic range:
+//
+// float *data = stbi_loadf(filename, &x, &y, &n, 0);
+//
+// If you load LDR images through this interface, those images will
+// be promoted to floating point values, run through the inverse of
+// constants corresponding to the above:
+//
+// stbi_ldr_to_hdr_scale(1.0f);
+// stbi_ldr_to_hdr_gamma(2.2f);
+//
+// Finally, given a filename (or an open file or memory block--see header
+// file for details) containing image data, you can query for the "most
+// appropriate" interface to use (that is, whether the image is HDR or
+// not), using:
+//
+// stbi_is_hdr(char *filename);
+
+#ifndef STBI_NO_STDIO
+#include
+#endif
+
+#define STBI_VERSION 1
+
+enum
+{
+ STBI_default = 0, // only used for req_comp
+
+ STBI_grey = 1,
+ STBI_grey_alpha = 2,
+ STBI_rgb = 3,
+ STBI_rgb_alpha = 4,
+};
+
+typedef unsigned char stbi_uc;
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+// WRITING API
+
+#if !defined(STBI_NO_WRITE) && !defined(STBI_NO_STDIO)
+// write a BMP/TGA file given tightly packed 'comp' channels (no padding, nor bmp-stride-padding)
+// (you must include the appropriate extension in the filename).
+// returns TRUE on success, FALSE if couldn't open file, error writing file
+extern int stbi_write_bmp (char const *filename, int x, int y, int comp, void *data);
+extern int stbi_write_tga (char const *filename, int x, int y, int comp, void *data);
+#endif
+
+// PRIMARY API - works on images of any type
+
+// load image by filename, open file, or memory buffer
+#ifndef STBI_NO_STDIO
+extern stbi_uc *stbi_load (char const *filename, int *x, int *y, int *comp, int req_comp);
+extern stbi_uc *stbi_load_from_file (FILE *f, int *x, int *y, int *comp, int req_comp);
+extern int stbi_info_from_file (FILE *f, int *x, int *y, int *comp);
+#endif
+extern stbi_uc *stbi_load_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp);
+// for stbi_load_from_file, file pointer is left pointing immediately after image
+
+#ifndef STBI_NO_HDR
+#ifndef STBI_NO_STDIO
+extern float *stbi_loadf (char const *filename, int *x, int *y, int *comp, int req_comp);
+extern float *stbi_loadf_from_file (FILE *f, int *x, int *y, int *comp, int req_comp);
+#endif
+extern float *stbi_loadf_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp);
+
+extern void stbi_hdr_to_ldr_gamma(float gamma);
+extern void stbi_hdr_to_ldr_scale(float scale);
+
+extern void stbi_ldr_to_hdr_gamma(float gamma);
+extern void stbi_ldr_to_hdr_scale(float scale);
+
+#endif // STBI_NO_HDR
+
+// get a VERY brief reason for failure
+// NOT THREADSAFE
+extern const char *stbi_failure_reason (void);
+
+// free the loaded image -- this is just free()
+extern void stbi_image_free (void *retval_from_stbi_load);
+
+// get image dimensions & components without fully decoding
+extern int stbi_info_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp);
+extern int stbi_is_hdr_from_memory(stbi_uc const *buffer, int len);
+#ifndef STBI_NO_STDIO
+extern int stbi_info (char const *filename, int *x, int *y, int *comp);
+extern int stbi_is_hdr (char const *filename);
+extern int stbi_is_hdr_from_file(FILE *f);
+#endif
+
+// ZLIB client - used by PNG, available for other purposes
+
+extern char *stbi_zlib_decode_malloc_guesssize(const char *buffer, int len, int initial_size, int *outlen);
+extern char *stbi_zlib_decode_malloc(const char *buffer, int len, int *outlen);
+extern int stbi_zlib_decode_buffer(char *obuffer, int olen, const char *ibuffer, int ilen);
+
+extern char *stbi_zlib_decode_noheader_malloc(const char *buffer, int len, int *outlen);
+extern int stbi_zlib_decode_noheader_buffer(char *obuffer, int olen, const char *ibuffer, int ilen);
+
+// TYPE-SPECIFIC ACCESS
+
+// is it a jpeg?
+extern int stbi_jpeg_test_memory (stbi_uc const *buffer, int len);
+extern stbi_uc *stbi_jpeg_load_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp);
+extern int stbi_jpeg_info_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp);
+
+#ifndef STBI_NO_STDIO
+extern stbi_uc *stbi_jpeg_load (char const *filename, int *x, int *y, int *comp, int req_comp);
+extern int stbi_jpeg_test_file (FILE *f);
+extern stbi_uc *stbi_jpeg_load_from_file (FILE *f, int *x, int *y, int *comp, int req_comp);
+
+extern int stbi_jpeg_info (char const *filename, int *x, int *y, int *comp);
+extern int stbi_jpeg_info_from_file (FILE *f, int *x, int *y, int *comp);
+#endif
+
+// is it a png?
+extern int stbi_png_test_memory (stbi_uc const *buffer, int len);
+extern stbi_uc *stbi_png_load_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp);
+extern int stbi_png_info_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *comp);
+
+#ifndef STBI_NO_STDIO
+extern stbi_uc *stbi_png_load (char const *filename, int *x, int *y, int *comp, int req_comp);
+extern int stbi_png_info (char const *filename, int *x, int *y, int *comp);
+extern int stbi_png_test_file (FILE *f);
+extern stbi_uc *stbi_png_load_from_file (FILE *f, int *x, int *y, int *comp, int req_comp);
+extern int stbi_png_info_from_file (FILE *f, int *x, int *y, int *comp);
+#endif
+
+// is it a bmp?
+extern int stbi_bmp_test_memory (stbi_uc const *buffer, int len);
+
+extern stbi_uc *stbi_bmp_load (char const *filename, int *x, int *y, int *comp, int req_comp);
+extern stbi_uc *stbi_bmp_load_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp);
+#ifndef STBI_NO_STDIO
+extern int stbi_bmp_test_file (FILE *f);
+extern stbi_uc *stbi_bmp_load_from_file (FILE *f, int *x, int *y, int *comp, int req_comp);
+#endif
+
+// is it a tga?
+extern int stbi_tga_test_memory (stbi_uc const *buffer, int len);
+
+extern stbi_uc *stbi_tga_load (char const *filename, int *x, int *y, int *comp, int req_comp);
+extern stbi_uc *stbi_tga_load_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp);
+#ifndef STBI_NO_STDIO
+extern int stbi_tga_test_file (FILE *f);
+extern stbi_uc *stbi_tga_load_from_file (FILE *f, int *x, int *y, int *comp, int req_comp);
+#endif
+
+// is it a psd?
+extern int stbi_psd_test_memory (stbi_uc const *buffer, int len);
+
+extern stbi_uc *stbi_psd_load (char const *filename, int *x, int *y, int *comp, int req_comp);
+extern stbi_uc *stbi_psd_load_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp);
+#ifndef STBI_NO_STDIO
+extern int stbi_psd_test_file (FILE *f);
+extern stbi_uc *stbi_psd_load_from_file (FILE *f, int *x, int *y, int *comp, int req_comp);
+#endif
+
+// is it an hdr?
+extern int stbi_hdr_test_memory (stbi_uc const *buffer, int len);
+
+extern float * stbi_hdr_load (char const *filename, int *x, int *y, int *comp, int req_comp);
+extern float * stbi_hdr_load_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp);
+#ifndef STBI_NO_STDIO
+extern int stbi_hdr_test_file (FILE *f);
+extern float * stbi_hdr_load_from_file (FILE *f, int *x, int *y, int *comp, int req_comp);
+#endif
+
+// define new loaders
+typedef struct
+{
+ int (*test_memory)(stbi_uc const *buffer, int len);
+ stbi_uc * (*load_from_memory)(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp);
+ #ifndef STBI_NO_STDIO
+ int (*test_file)(FILE *f);
+ stbi_uc * (*load_from_file)(FILE *f, int *x, int *y, int *comp, int req_comp);
+ #endif
+} stbi_loader;
+
+// register a loader by filling out the above structure (you must defined ALL functions)
+// returns 1 if added or already added, 0 if not added (too many loaders)
+// NOT THREADSAFE
+extern int stbi_register_loader(stbi_loader *loader);
+
+// define faster low-level operations (typically SIMD support)
+#if STBI_SIMD
+typedef void (*stbi_idct_8x8)(uint8 *out, int out_stride, short data[64], unsigned short *dequantize);
+// compute an integer IDCT on "input"
+// input[x] = data[x] * dequantize[x]
+// write results to 'out': 64 samples, each run of 8 spaced by 'out_stride'
+// CLAMP results to 0..255
+typedef void (*stbi_YCbCr_to_RGB_run)(uint8 *output, uint8 const *y, uint8 const *cb, uint8 const *cr, int count, int step);
+// compute a conversion from YCbCr to RGB
+// 'count' pixels
+// write pixels to 'output'; each pixel is 'step' bytes (either 3 or 4; if 4, write '255' as 4th), order R,G,B
+// y: Y input channel
+// cb: Cb input channel; scale/biased to be 0..255
+// cr: Cr input channel; scale/biased to be 0..255
+
+extern void stbi_install_idct(stbi_idct_8x8 func);
+extern void stbi_install_YCbCr_to_RGB(stbi_YCbCr_to_RGB_run func);
+#endif // STBI_SIMD
+
+#ifdef __cplusplus
+}
+#endif
+
+//
+//
+//// end header file /////////////////////////////////////////////////////
+#endif // STBI_INCLUDE_STB_IMAGE_H
+
+#ifndef STBI_HEADER_FILE_ONLY
+
+#ifndef STBI_NO_HDR
+#include // ldexp
+#include // strcmp
+#endif
+
+#ifndef STBI_NO_STDIO
+#include
+#endif
+#include
+#include
+#include
+#include
+
+#ifndef _MSC_VER
+ #ifdef __cplusplus
+ #define __forceinline inline
+ #else
+ #define __forceinline
+ #endif
+#endif
+
+
+// implementation:
+typedef unsigned char uint8;
+typedef unsigned short uint16;
+typedef signed short int16;
+typedef unsigned int uint32;
+typedef signed int int32;
+typedef unsigned int uint;
+
+// should produce compiler error if size is wrong
+typedef unsigned char validate_uint32[sizeof(uint32)==4];
+
+#if defined(STBI_NO_STDIO) && !defined(STBI_NO_WRITE)
+#define STBI_NO_WRITE
+#endif
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// Generic API that works on all image types
+//
+
+// this is not threadsafe
+static const char *failure_reason;
+
+const char *stbi_failure_reason(void)
+{
+ return failure_reason;
+}
+
+static int e(const char *str)
+{
+ failure_reason = str;
+ return 0;
+}
+
+#ifdef STBI_NO_FAILURE_STRINGS
+ #define e(x,y) 0
+#elif defined(STBI_FAILURE_USERMSG)
+ #define e(x,y) e(y)
+#else
+ #define e(x,y) e(x)
+#endif
+
+#define epf(x,y) ((float *) (e(x,y)?NULL:NULL))
+#define epuc(x,y) ((unsigned char *) (e(x,y)?NULL:NULL))
+
+void stbi_image_free(void *retval_from_stbi_load)
+{
+ free(retval_from_stbi_load);
+}
+
+#define MAX_LOADERS 32
+stbi_loader *loaders[MAX_LOADERS];
+static int max_loaders = 0;
+
+int stbi_register_loader(stbi_loader *loader)
+{
+ int i;
+ for (i=0; i < MAX_LOADERS; ++i) {
+ // already present?
+ if (loaders[i] == loader)
+ return 1;
+ // end of the list?
+ if (loaders[i] == NULL) {
+ loaders[i] = loader;
+ max_loaders = i+1;
+ return 1;
+ }
+ }
+ // no room for it
+ return 0;
+}
+
+#ifndef STBI_NO_HDR
+static float *ldr_to_hdr(stbi_uc *data, int x, int y, int comp);
+static stbi_uc *hdr_to_ldr(float *data, int x, int y, int comp);
+#endif
+
+#ifndef STBI_NO_STDIO
+unsigned char *stbi_load(char const *filename, int *x, int *y, int *comp, int req_comp)
+{
+ FILE *f = fopen(filename, "rb");
+ unsigned char *result;
+ if (!f) return epuc("can't fopen", "Unable to open file");
+ result = stbi_load_from_file(f,x,y,comp,req_comp);
+ fclose(f);
+ return result;
+}
+
+unsigned char *stbi_load_from_file(FILE *f, int *x, int *y, int *comp, int req_comp)
+{
+ int i;
+ if (stbi_jpeg_test_file(f))
+ return stbi_jpeg_load_from_file(f,x,y,comp,req_comp);
+ if (stbi_png_test_file(f))
+ return stbi_png_load_from_file(f,x,y,comp,req_comp);
+ if (stbi_bmp_test_file(f))
+ return stbi_bmp_load_from_file(f,x,y,comp,req_comp);
+ if (stbi_psd_test_file(f))
+ return stbi_psd_load_from_file(f,x,y,comp,req_comp);
+ #ifndef STBI_NO_HDR
+ if (stbi_hdr_test_file(f)) {
+ float *hdr = stbi_hdr_load_from_file(f, x,y,comp,req_comp);
+ return hdr_to_ldr(hdr, *x, *y, req_comp ? req_comp : *comp);
+ }
+ #endif
+ for (i=0; i < max_loaders; ++i)
+ if (loaders[i]->test_file(f))
+ return loaders[i]->load_from_file(f,x,y,comp,req_comp);
+ // test tga last because it's a crappy test!
+ if (stbi_tga_test_file(f))
+ return stbi_tga_load_from_file(f,x,y,comp,req_comp);
+ return epuc("unknown image type", "Image not of any known type, or corrupt");
+}
+#endif
+
+unsigned char *stbi_load_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp)
+{
+ int i;
+ if (stbi_jpeg_test_memory(buffer,len))
+ return stbi_jpeg_load_from_memory(buffer,len,x,y,comp,req_comp);
+ if (stbi_png_test_memory(buffer,len))
+ return stbi_png_load_from_memory(buffer,len,x,y,comp,req_comp);
+ if (stbi_bmp_test_memory(buffer,len))
+ return stbi_bmp_load_from_memory(buffer,len,x,y,comp,req_comp);
+ if (stbi_psd_test_memory(buffer,len))
+ return stbi_psd_load_from_memory(buffer,len,x,y,comp,req_comp);
+ #ifndef STBI_NO_HDR
+ if (stbi_hdr_test_memory(buffer, len)) {
+ float *hdr = stbi_hdr_load_from_memory(buffer, len,x,y,comp,req_comp);
+ return hdr_to_ldr(hdr, *x, *y, req_comp ? req_comp : *comp);
+ }
+ #endif
+ for (i=0; i < max_loaders; ++i)
+ if (loaders[i]->test_memory(buffer,len))
+ return loaders[i]->load_from_memory(buffer,len,x,y,comp,req_comp);
+ // test tga last because it's a crappy test!
+ if (stbi_tga_test_memory(buffer,len))
+ return stbi_tga_load_from_memory(buffer,len,x,y,comp,req_comp);
+ return epuc("unknown image type", "Image not of any known type, or corrupt");
+}
+
+#ifndef STBI_NO_HDR
+
+#ifndef STBI_NO_STDIO
+float *stbi_loadf(char const *filename, int *x, int *y, int *comp, int req_comp)
+{
+ FILE *f = fopen(filename, "rb");
+ float *result;
+ if (!f) return epf("can't fopen", "Unable to open file");
+ result = stbi_loadf_from_file(f,x,y,comp,req_comp);
+ fclose(f);
+ return result;
+}
+
+float *stbi_loadf_from_file(FILE *f, int *x, int *y, int *comp, int req_comp)
+{
+ unsigned char *data;
+ #ifndef STBI_NO_HDR
+ if (stbi_hdr_test_file(f))
+ return stbi_hdr_load_from_file(f,x,y,comp,req_comp);
+ #endif
+ data = stbi_load_from_file(f, x, y, comp, req_comp);
+ if (data)
+ return ldr_to_hdr(data, *x, *y, req_comp ? req_comp : *comp);
+ return epf("unknown image type", "Image not of any known type, or corrupt");
+}
+#endif
+
+float *stbi_loadf_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp)
+{
+ stbi_uc *data;
+ #ifndef STBI_NO_HDR
+ if (stbi_hdr_test_memory(buffer, len))
+ return stbi_hdr_load_from_memory(buffer, len,x,y,comp,req_comp);
+ #endif
+ data = stbi_load_from_memory(buffer, len, x, y, comp, req_comp);
+ if (data)
+ return ldr_to_hdr(data, *x, *y, req_comp ? req_comp : *comp);
+ return epf("unknown image type", "Image not of any known type, or corrupt");
+}
+#endif
+
+// these is-hdr-or-not is defined independent of whether STBI_NO_HDR is
+// defined, for API simplicity; if STBI_NO_HDR is defined, it always
+// reports false!
+
+int stbi_is_hdr_from_memory(stbi_uc const *buffer, int len)
+{
+ #ifndef STBI_NO_HDR
+ return stbi_hdr_test_memory(buffer, len);
+ #else
+ return 0;
+ #endif
+}
+
+#ifndef STBI_NO_STDIO
+extern int stbi_is_hdr (char const *filename)
+{
+ FILE *f = fopen(filename, "rb");
+ int result=0;
+ if (f) {
+ result = stbi_is_hdr_from_file(f);
+ fclose(f);
+ }
+ return result;
+}
+
+extern int stbi_is_hdr_from_file(FILE *f)
+{
+ #ifndef STBI_NO_HDR
+ return stbi_hdr_test_file(f);
+ #else
+ return 0;
+ #endif
+}
+
+#endif
+
+// @TODO: get image dimensions & components without fully decoding
+#ifndef STBI_NO_STDIO
+extern int stbi_info (char const *filename, int *x, int *y, int *comp);
+extern int stbi_info_from_file (FILE *f, int *x, int *y, int *comp);
+#endif
+extern int stbi_info_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp);
+
+#ifndef STBI_NO_HDR
+static float h2l_gamma_i=1.0f/2.2f, h2l_scale_i=1.0f;
+static float l2h_gamma=2.2f, l2h_scale=1.0f;
+
+void stbi_hdr_to_ldr_gamma(float gamma) { h2l_gamma_i = 1/gamma; }
+void stbi_hdr_to_ldr_scale(float scale) { h2l_scale_i = 1/scale; }
+
+void stbi_ldr_to_hdr_gamma(float gamma) { l2h_gamma = gamma; }
+void stbi_ldr_to_hdr_scale(float scale) { l2h_scale = scale; }
+#endif
+
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// Common code used by all image loaders
+//
+
+enum
+{
+ SCAN_load=0,
+ SCAN_type,
+ SCAN_header,
+};
+
+typedef struct
+{
+ uint32 img_x, img_y;
+ int img_n, img_out_n;
+
+ #ifndef STBI_NO_STDIO
+ FILE *img_file;
+ #endif
+ uint8 *img_buffer, *img_buffer_end;
+} stbi;
+
+#ifndef STBI_NO_STDIO
+static void start_file(stbi *s, FILE *f)
+{
+ s->img_file = f;
+ s->img_buffer = NULL;
+ s->img_buffer_end = NULL;
+}
+#endif
+
+static void start_mem(stbi *s, uint8 const *buffer, int len)
+{
+#ifndef STBI_NO_STDIO
+ s->img_file = NULL;
+#endif
+ s->img_buffer = (uint8 *) buffer;
+ s->img_buffer_end = (uint8 *) buffer+len;
+}
+
+__forceinline static int get8(stbi *s)
+{
+#ifndef STBI_NO_STDIO
+ if (s->img_file) {
+ int c = fgetc(s->img_file);
+ return c == EOF ? 0 : c;
+ }
+#endif
+ if (s->img_buffer < s->img_buffer_end)
+ return *s->img_buffer++;
+ return 0;
+}
+
+__forceinline static int at_eof(stbi *s)
+{
+#ifndef STBI_NO_STDIO
+ if (s->img_file)
+ return feof(s->img_file);
+#endif
+ return s->img_buffer >= s->img_buffer_end;
+}
+
+__forceinline static uint8 get8u(stbi *s)
+{
+ return (uint8) get8(s);
+}
+
+static void skip(stbi *s, int n)
+{
+#ifndef STBI_NO_STDIO
+ if (s->img_file)
+ fseek(s->img_file, n, SEEK_CUR);
+ else
+#endif
+ s->img_buffer += n;
+}
+
+static int get16(stbi *s)
+{
+ int z = get8(s);
+ return (z << 8) + get8(s);
+}
+
+static uint32 get32(stbi *s)
+{
+ uint32 z = get16(s);
+ return (z << 16) + get16(s);
+}
+
+static int get16le(stbi *s)
+{
+ int z = get8(s);
+ return z + (get8(s) << 8);
+}
+
+static uint32 get32le(stbi *s)
+{
+ uint32 z = get16le(s);
+ return z + (get16le(s) << 16);
+}
+
+static void getn(stbi *s, stbi_uc *buffer, int n)
+{
+#ifndef STBI_NO_STDIO
+ if (s->img_file) {
+ fread(buffer, 1, n, s->img_file);
+ return;
+ }
+#endif
+ memcpy(buffer, s->img_buffer, n);
+ s->img_buffer += n;
+}
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// generic converter from built-in img_n to req_comp
+// individual types do this automatically as much as possible (e.g. jpeg
+// does all cases internally since it needs to colorspace convert anyway,
+// and it never has alpha, so very few cases ). png can automatically
+// interleave an alpha=255 channel, but falls back to this for other cases
+//
+// assume data buffer is malloced, so malloc a new one and free that one
+// only failure mode is malloc failing
+
+static uint8 compute_y(int r, int g, int b)
+{
+ return (uint8) (((r*77) + (g*150) + (29*b)) >> 8);
+}
+
+static unsigned char *convert_format(unsigned char *data, int img_n, int req_comp, uint x, uint y)
+{
+ int i,j;
+ unsigned char *good;
+
+ if (req_comp == img_n) return data;
+ assert(req_comp >= 1 && req_comp <= 4);
+
+ good = (unsigned char *) malloc(req_comp * x * y);
+ if (good == NULL) {
+ free(data);
+ return epuc("outofmem", "Out of memory");
+ }
+
+ for (j=0; j < (int) y; ++j) {
+ unsigned char *src = data + j * x * img_n ;
+ unsigned char *dest = good + j * x * req_comp;
+
+ #define COMBO(a,b) ((a)*8+(b))
+ #define CASE(a,b) case COMBO(a,b): for(i=x-1; i >= 0; --i, src += a, dest += b)
+ // convert source image with img_n components to one with req_comp components;
+ // avoid switch per pixel, so use switch per scanline and massive macros
+ switch(COMBO(img_n, req_comp)) {
+ CASE(1,2) dest[0]=src[0], dest[1]=255; break;
+ CASE(1,3) dest[0]=dest[1]=dest[2]=src[0]; break;
+ CASE(1,4) dest[0]=dest[1]=dest[2]=src[0], dest[3]=255; break;
+ CASE(2,1) dest[0]=src[0]; break;
+ CASE(2,3) dest[0]=dest[1]=dest[2]=src[0]; break;
+ CASE(2,4) dest[0]=dest[1]=dest[2]=src[0], dest[3]=src[1]; break;
+ CASE(3,4) dest[0]=src[0],dest[1]=src[1],dest[2]=src[2],dest[3]=255; break;
+ CASE(3,1) dest[0]=compute_y(src[0],src[1],src[2]); break;
+ CASE(3,2) dest[0]=compute_y(src[0],src[1],src[2]), dest[1] = 255; break;
+ CASE(4,1) dest[0]=compute_y(src[0],src[1],src[2]); break;
+ CASE(4,2) dest[0]=compute_y(src[0],src[1],src[2]), dest[1] = src[3]; break;
+ CASE(4,3) dest[0]=src[0],dest[1]=src[1],dest[2]=src[2]; break;
+ default: assert(0);
+ }
+ #undef CASE
+ }
+
+ free(data);
+ return good;
+}
+
+#ifndef STBI_NO_HDR
+static float *ldr_to_hdr(stbi_uc *data, int x, int y, int comp)
+{
+ int i,k,n;
+ float *output = (float *) malloc(x * y * comp * sizeof(float));
+ if (output == NULL) { free(data); return epf("outofmem", "Out of memory"); }
+ // compute number of non-alpha components
+ if (comp & 1) n = comp; else n = comp-1;
+ for (i=0; i < x*y; ++i) {
+ for (k=0; k < n; ++k) {
+ output[i*comp + k] = (float) pow(data[i*comp+k]/255.0f, l2h_gamma) * l2h_scale;
+ }
+ if (k < comp) output[i*comp + k] = data[i*comp+k]/255.0f;
+ }
+ free(data);
+ return output;
+}
+
+#define float2int(x) ((int) (x))
+static stbi_uc *hdr_to_ldr(float *data, int x, int y, int comp)
+{
+ int i,k,n;
+ stbi_uc *output = (stbi_uc *) malloc(x * y * comp);
+ if (output == NULL) { free(data); return epuc("outofmem", "Out of memory"); }
+ // compute number of non-alpha components
+ if (comp & 1) n = comp; else n = comp-1;
+ for (i=0; i < x*y; ++i) {
+ for (k=0; k < n; ++k) {
+ float z = (float) pow(data[i*comp+k]*h2l_scale_i, h2l_gamma_i) * 255 + 0.5f;
+ if (z < 0) z = 0;
+ if (z > 255) z = 255;
+ output[i*comp + k] = (stbi_uc)float2int(z);
+ }
+ if (k < comp) {
+ float z = data[i*comp+k] * 255 + 0.5f;
+ if (z < 0) z = 0;
+ if (z > 255) z = 255;
+ output[i*comp + k] = (stbi_uc)float2int(z);
+ }
+ }
+ free(data);
+ return output;
+}
+#endif
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// "baseline" JPEG/JFIF decoder (not actually fully baseline implementation)
+//
+// simple implementation
+// - channel subsampling of at most 2 in each dimension
+// - doesn't support delayed output of y-dimension
+// - simple interface (only one output format: 8-bit interleaved RGB)
+// - doesn't try to recover corrupt jpegs
+// - doesn't allow partial loading, loading multiple at once
+// - still fast on x86 (copying globals into locals doesn't help x86)
+// - allocates lots of intermediate memory (full size of all components)
+// - non-interleaved case requires this anyway
+// - allows good upsampling (see next)
+// high-quality
+// - upsampled channels are bilinearly interpolated, even across blocks
+// - quality integer IDCT derived from IJG's 'slow'
+// performance
+// - fast huffman; reasonable integer IDCT
+// - uses a lot of intermediate memory, could cache poorly
+// - load http://nothings.org/remote/anemones.jpg 3 times on 2.8Ghz P4
+// stb_jpeg: 1.34 seconds (MSVC6, default release build)
+// stb_jpeg: 1.06 seconds (MSVC6, processor = Pentium Pro)
+// IJL11.dll: 1.08 seconds (compiled by intel)
+// IJG 1998: 0.98 seconds (MSVC6, makefile provided by IJG)
+// IJG 1998: 0.95 seconds (MSVC6, makefile + proc=PPro)
+
+// huffman decoding acceleration
+#define FAST_BITS 9 // larger handles more cases; smaller stomps less cache
+
+typedef struct
+{
+ uint8 fast[1 << FAST_BITS];
+ // weirdly, repacking this into AoS is a 10% speed loss, instead of a win
+ uint16 code[256];
+ uint8 values[256];
+ uint8 size[257];
+ unsigned int maxcode[18];
+ int delta[17]; // old 'firstsymbol' - old 'firstcode'
+} huffman;
+
+typedef struct
+{
+ #if STBI_SIMD
+ unsigned short dequant2[4][64];
+ #endif
+ stbi s;
+ huffman huff_dc[4];
+ huffman huff_ac[4];
+ uint8 dequant[4][64];
+
+// sizes for components, interleaved MCUs
+ int img_h_max, img_v_max;
+ int img_mcu_x, img_mcu_y;
+ int img_mcu_w, img_mcu_h;
+
+// definition of jpeg image component
+ struct
+ {
+ int id;
+ int h,v;
+ int tq;
+ int hd,ha;
+ int dc_pred;
+
+ int x,y,w2,h2;
+ uint8 *data;
+ void *raw_data;
+ uint8 *linebuf;
+ } img_comp[4];
+
+ uint32 code_buffer; // jpeg entropy-coded buffer
+ int code_bits; // number of valid bits
+ unsigned char marker; // marker seen while filling entropy buffer
+ int nomore; // flag if we saw a marker so must stop
+
+ int scan_n, order[4];
+ int restart_interval, todo;
+} jpeg;
+
+static int build_huffman(huffman *h, int *count)
+{
+ int i,j,k=0,code;
+ // build size list for each symbol (from JPEG spec)
+ for (i=0; i < 16; ++i)
+ for (j=0; j < count[i]; ++j)
+ h->size[k++] = (uint8) (i+1);
+ h->size[k] = 0;
+
+ // compute actual symbols (from jpeg spec)
+ code = 0;
+ k = 0;
+ for(j=1; j <= 16; ++j) {
+ // compute delta to add to code to compute symbol id
+ h->delta[j] = k - code;
+ if (h->size[k] == j) {
+ while (h->size[k] == j)
+ h->code[k++] = (uint16) (code++);
+ if (code-1 >= (1 << j)) return e("bad code lengths","Corrupt JPEG");
+ }
+ // compute largest code + 1 for this size, preshifted as needed later
+ h->maxcode[j] = code << (16-j);
+ code <<= 1;
+ }
+ h->maxcode[j] = 0xffffffff;
+
+ // build non-spec acceleration table; 255 is flag for not-accelerated
+ memset(h->fast, 255, 1 << FAST_BITS);
+ for (i=0; i < k; ++i) {
+ int s = h->size[i];
+ if (s <= FAST_BITS) {
+ int c = h->code[i] << (FAST_BITS-s);
+ int m = 1 << (FAST_BITS-s);
+ for (j=0; j < m; ++j) {
+ h->fast[c+j] = (uint8) i;
+ }
+ }
+ }
+ return 1;
+}
+
+static void grow_buffer_unsafe(jpeg *j)
+{
+ do {
+ int b = j->nomore ? 0 : get8(&j->s);
+ if (b == 0xff) {
+ int c = get8(&j->s);
+ if (c != 0) {
+ j->marker = (unsigned char) c;
+ j->nomore = 1;
+ return;
+ }
+ }
+ j->code_buffer = (j->code_buffer << 8) | b;
+ j->code_bits += 8;
+ } while (j->code_bits <= 24);
+}
+
+// (1 << n) - 1
+static uint32 bmask[17]={0,1,3,7,15,31,63,127,255,511,1023,2047,4095,8191,16383,32767,65535};
+
+// decode a jpeg huffman value from the bitstream
+__forceinline static int decode(jpeg *j, huffman *h)
+{
+ unsigned int temp;
+ int c,k;
+
+ if (j->code_bits < 16) grow_buffer_unsafe(j);
+
+ // look at the top FAST_BITS and determine what symbol ID it is,
+ // if the code is <= FAST_BITS
+ c = (j->code_buffer >> (j->code_bits - FAST_BITS)) & ((1 << FAST_BITS)-1);
+ k = h->fast[c];
+ if (k < 255) {
+ if (h->size[k] > j->code_bits)
+ return -1;
+ j->code_bits -= h->size[k];
+ return h->values[k];
+ }
+
+ // naive test is to shift the code_buffer down so k bits are
+ // valid, then test against maxcode. To speed this up, we've
+ // preshifted maxcode left so that it has (16-k) 0s at the
+ // end; in other words, regardless of the number of bits, it
+ // wants to be compared against something shifted to have 16;
+ // that way we don't need to shift inside the loop.
+ if (j->code_bits < 16)
+ temp = (j->code_buffer << (16 - j->code_bits)) & 0xffff;
+ else
+ temp = (j->code_buffer >> (j->code_bits - 16)) & 0xffff;
+ for (k=FAST_BITS+1 ; ; ++k)
+ if (temp < h->maxcode[k])
+ break;
+ if (k == 17) {
+ // error! code not found
+ j->code_bits -= 16;
+ return -1;
+ }
+
+ if (k > j->code_bits)
+ return -1;
+
+ // convert the huffman code to the symbol id
+ c = ((j->code_buffer >> (j->code_bits - k)) & bmask[k]) + h->delta[k];
+ assert((((j->code_buffer) >> (j->code_bits - h->size[c])) & bmask[h->size[c]]) == h->code[c]);
+
+ // convert the id to a symbol
+ j->code_bits -= k;
+ return h->values[c];
+}
+
+// combined JPEG 'receive' and JPEG 'extend', since baseline
+// always extends everything it receives.
+__forceinline static int extend_receive(jpeg *j, int n)
+{
+ unsigned int m = 1 << (n-1);
+ unsigned int k;
+ if (j->code_bits < n) grow_buffer_unsafe(j);
+ k = (j->code_buffer >> (j->code_bits - n)) & bmask[n];
+ j->code_bits -= n;
+ // the following test is probably a random branch that won't
+ // predict well. I tried to table accelerate it but failed.
+ // maybe it's compiling as a conditional move?
+ if (k < m)
+ return (-1 << n) + k + 1;
+ else
+ return k;
+}
+
+// given a value that's at position X in the zigzag stream,
+// where does it appear in the 8x8 matrix coded as row-major?
+static uint8 dezigzag[64+15] =
+{
+ 0, 1, 8, 16, 9, 2, 3, 10,
+ 17, 24, 32, 25, 18, 11, 4, 5,
+ 12, 19, 26, 33, 40, 48, 41, 34,
+ 27, 20, 13, 6, 7, 14, 21, 28,
+ 35, 42, 49, 56, 57, 50, 43, 36,
+ 29, 22, 15, 23, 30, 37, 44, 51,
+ 58, 59, 52, 45, 38, 31, 39, 46,
+ 53, 60, 61, 54, 47, 55, 62, 63,
+ // let corrupt input sample past end
+ 63, 63, 63, 63, 63, 63, 63, 63,
+ 63, 63, 63, 63, 63, 63, 63
+};
+
+// decode one 64-entry block--
+static int decode_block(jpeg *j, short data[64], huffman *hdc, huffman *hac, int b)
+{
+ int diff,dc,k;
+ int t = decode(j, hdc);
+ if (t < 0) return e("bad huffman code","Corrupt JPEG");
+
+ // 0 all the ac values now so we can do it 32-bits at a time
+ memset(data,0,64*sizeof(data[0]));
+
+ diff = t ? extend_receive(j, t) : 0;
+ dc = j->img_comp[b].dc_pred + diff;
+ j->img_comp[b].dc_pred = dc;
+ data[0] = (short) dc;
+
+ // decode AC components, see JPEG spec
+ k = 1;
+ do {
+ int r,s;
+ int rs = decode(j, hac);
+ if (rs < 0) return e("bad huffman code","Corrupt JPEG");
+ s = rs & 15;
+ r = rs >> 4;
+ if (s == 0) {
+ if (rs != 0xf0) break; // end block
+ k += 16;
+ } else {
+ k += r;
+ // decode into unzigzag'd location
+ data[dezigzag[k++]] = (short) extend_receive(j,s);
+ }
+ } while (k < 64);
+ return 1;
+}
+
+// take a -128..127 value and clamp it and convert to 0..255
+__forceinline static uint8 clamp(int x)
+{
+ x += 128;
+ // trick to use a single test to catch both cases
+ if ((unsigned int) x > 255) {
+ if (x < 0) return 0;
+ if (x > 255) return 255;
+ }
+ return (uint8) x;
+}
+
+#define f2f(x) (int) (((x) * 4096 + 0.5))
+#define fsh(x) ((x) << 12)
+
+// derived from jidctint -- DCT_ISLOW
+#define IDCT_1D(s0,s1,s2,s3,s4,s5,s6,s7) \
+ int t0,t1,t2,t3,p1,p2,p3,p4,p5,x0,x1,x2,x3; \
+ p2 = s2; \
+ p3 = s6; \
+ p1 = (p2+p3) * f2f(0.5411961f); \
+ t2 = p1 + p3*f2f(-1.847759065f); \
+ t3 = p1 + p2*f2f( 0.765366865f); \
+ p2 = s0; \
+ p3 = s4; \
+ t0 = fsh(p2+p3); \
+ t1 = fsh(p2-p3); \
+ x0 = t0+t3; \
+ x3 = t0-t3; \
+ x1 = t1+t2; \
+ x2 = t1-t2; \
+ t0 = s7; \
+ t1 = s5; \
+ t2 = s3; \
+ t3 = s1; \
+ p3 = t0+t2; \
+ p4 = t1+t3; \
+ p1 = t0+t3; \
+ p2 = t1+t2; \
+ p5 = (p3+p4)*f2f( 1.175875602f); \
+ t0 = t0*f2f( 0.298631336f); \
+ t1 = t1*f2f( 2.053119869f); \
+ t2 = t2*f2f( 3.072711026f); \
+ t3 = t3*f2f( 1.501321110f); \
+ p1 = p5 + p1*f2f(-0.899976223f); \
+ p2 = p5 + p2*f2f(-2.562915447f); \
+ p3 = p3*f2f(-1.961570560f); \
+ p4 = p4*f2f(-0.390180644f); \
+ t3 += p1+p4; \
+ t2 += p2+p3; \
+ t1 += p2+p4; \
+ t0 += p1+p3;
+
+#if !STBI_SIMD
+// .344 seconds on 3*anemones.jpg
+static void idct_block(uint8 *out, int out_stride, short data[64], uint8 *dequantize)
+{
+ int i,val[64],*v=val;
+ uint8 *o,*dq = dequantize;
+ short *d = data;
+
+ // columns
+ for (i=0; i < 8; ++i,++d,++dq, ++v) {
+ // if all zeroes, shortcut -- this avoids dequantizing 0s and IDCTing
+ if (d[ 8]==0 && d[16]==0 && d[24]==0 && d[32]==0
+ && d[40]==0 && d[48]==0 && d[56]==0) {
+ // no shortcut 0 seconds
+ // (1|2|3|4|5|6|7)==0 0 seconds
+ // all separate -0.047 seconds
+ // 1 && 2|3 && 4|5 && 6|7: -0.047 seconds
+ int dcterm = d[0] * dq[0] << 2;
+ v[0] = v[8] = v[16] = v[24] = v[32] = v[40] = v[48] = v[56] = dcterm;
+ } else {
+ IDCT_1D(d[ 0]*dq[ 0],d[ 8]*dq[ 8],d[16]*dq[16],d[24]*dq[24],
+ d[32]*dq[32],d[40]*dq[40],d[48]*dq[48],d[56]*dq[56])
+ // constants scaled things up by 1<<12; let's bring them back
+ // down, but keep 2 extra bits of precision
+ x0 += 512; x1 += 512; x2 += 512; x3 += 512;
+ v[ 0] = (x0+t3) >> 10;
+ v[56] = (x0-t3) >> 10;
+ v[ 8] = (x1+t2) >> 10;
+ v[48] = (x1-t2) >> 10;
+ v[16] = (x2+t1) >> 10;
+ v[40] = (x2-t1) >> 10;
+ v[24] = (x3+t0) >> 10;
+ v[32] = (x3-t0) >> 10;
+ }
+ }
+
+ for (i=0, v=val, o=out; i < 8; ++i,v+=8,o+=out_stride) {
+ // no fast case since the first 1D IDCT spread components out
+ IDCT_1D(v[0],v[1],v[2],v[3],v[4],v[5],v[6],v[7])
+ // constants scaled things up by 1<<12, plus we had 1<<2 from first
+ // loop, plus horizontal and vertical each scale by sqrt(8) so together
+ // we've got an extra 1<<3, so 1<<17 total we need to remove.
+ x0 += 65536; x1 += 65536; x2 += 65536; x3 += 65536;
+ o[0] = clamp((x0+t3) >> 17);
+ o[7] = clamp((x0-t3) >> 17);
+ o[1] = clamp((x1+t2) >> 17);
+ o[6] = clamp((x1-t2) >> 17);
+ o[2] = clamp((x2+t1) >> 17);
+ o[5] = clamp((x2-t1) >> 17);
+ o[3] = clamp((x3+t0) >> 17);
+ o[4] = clamp((x3-t0) >> 17);
+ }
+}
+#else
+static void idct_block(uint8 *out, int out_stride, short data[64], unsigned short *dequantize)
+{
+ int i,val[64],*v=val;
+ uint8 *o;
+ unsigned short *dq = dequantize;
+ short *d = data;
+
+ // columns
+ for (i=0; i < 8; ++i,++d,++dq, ++v) {
+ // if all zeroes, shortcut -- this avoids dequantizing 0s and IDCTing
+ if (d[ 8]==0 && d[16]==0 && d[24]==0 && d[32]==0
+ && d[40]==0 && d[48]==0 && d[56]==0) {
+ // no shortcut 0 seconds
+ // (1|2|3|4|5|6|7)==0 0 seconds
+ // all separate -0.047 seconds
+ // 1 && 2|3 && 4|5 && 6|7: -0.047 seconds
+ int dcterm = d[0] * dq[0] << 2;
+ v[0] = v[8] = v[16] = v[24] = v[32] = v[40] = v[48] = v[56] = dcterm;
+ } else {
+ IDCT_1D(d[ 0]*dq[ 0],d[ 8]*dq[ 8],d[16]*dq[16],d[24]*dq[24],
+ d[32]*dq[32],d[40]*dq[40],d[48]*dq[48],d[56]*dq[56])
+ // constants scaled things up by 1<<12; let's bring them back
+ // down, but keep 2 extra bits of precision
+ x0 += 512; x1 += 512; x2 += 512; x3 += 512;
+ v[ 0] = (x0+t3) >> 10;
+ v[56] = (x0-t3) >> 10;
+ v[ 8] = (x1+t2) >> 10;
+ v[48] = (x1-t2) >> 10;
+ v[16] = (x2+t1) >> 10;
+ v[40] = (x2-t1) >> 10;
+ v[24] = (x3+t0) >> 10;
+ v[32] = (x3-t0) >> 10;
+ }
+ }
+
+ for (i=0, v=val, o=out; i < 8; ++i,v+=8,o+=out_stride) {
+ // no fast case since the first 1D IDCT spread components out
+ IDCT_1D(v[0],v[1],v[2],v[3],v[4],v[5],v[6],v[7])
+ // constants scaled things up by 1<<12, plus we had 1<<2 from first
+ // loop, plus horizontal and vertical each scale by sqrt(8) so together
+ // we've got an extra 1<<3, so 1<<17 total we need to remove.
+ x0 += 65536; x1 += 65536; x2 += 65536; x3 += 65536;
+ o[0] = clamp((x0+t3) >> 17);
+ o[7] = clamp((x0-t3) >> 17);
+ o[1] = clamp((x1+t2) >> 17);
+ o[6] = clamp((x1-t2) >> 17);
+ o[2] = clamp((x2+t1) >> 17);
+ o[5] = clamp((x2-t1) >> 17);
+ o[3] = clamp((x3+t0) >> 17);
+ o[4] = clamp((x3-t0) >> 17);
+ }
+}
+static stbi_idct_8x8 stbi_idct_installed = idct_block;
+
+extern void stbi_install_idct(stbi_idct_8x8 func)
+{
+ stbi_idct_installed = func;
+}
+#endif
+
+#define MARKER_none 0xff
+// if there's a pending marker from the entropy stream, return that
+// otherwise, fetch from the stream and get a marker. if there's no
+// marker, return 0xff, which is never a valid marker value
+static uint8 get_marker(jpeg *j)
+{
+ uint8 x;
+ if (j->marker != MARKER_none) { x = j->marker; j->marker = MARKER_none; return x; }
+ x = get8u(&j->s);
+ if (x != 0xff) return MARKER_none;
+ while (x == 0xff)
+ x = get8u(&j->s);
+ return x;
+}
+
+// in each scan, we'll have scan_n components, and the order
+// of the components is specified by order[]
+#define RESTART(x) ((x) >= 0xd0 && (x) <= 0xd7)
+
+// after a restart interval, reset the entropy decoder and
+// the dc prediction
+static void reset(jpeg *j)
+{
+ j->code_bits = 0;
+ j->code_buffer = 0;
+ j->nomore = 0;
+ j->img_comp[0].dc_pred = j->img_comp[1].dc_pred = j->img_comp[2].dc_pred = 0;
+ j->marker = MARKER_none;
+ j->todo = j->restart_interval ? j->restart_interval : 0x7fffffff;
+ // no more than 1<<31 MCUs if no restart_interal? that's plenty safe,
+ // since we don't even allow 1<<30 pixels
+}
+
+static int parse_entropy_coded_data(jpeg *z)
+{
+ reset(z);
+ if (z->scan_n == 1) {
+ int i,j;
+ #if STBI_SIMD
+ __declspec(align(16))
+ #endif
+ short data[64];
+ int n = z->order[0];
+ // non-interleaved data, we just need to process one block at a time,
+ // in trivial scanline order
+ // number of blocks to do just depends on how many actual "pixels" this
+ // component has, independent of interleaved MCU blocking and such
+ int w = (z->img_comp[n].x+7) >> 3;
+ int h = (z->img_comp[n].y+7) >> 3;
+ for (j=0; j < h; ++j) {
+ for (i=0; i < w; ++i) {
+ if (!decode_block(z, data, z->huff_dc+z->img_comp[n].hd, z->huff_ac+z->img_comp[n].ha, n)) return 0;
+ #if STBI_SIMD
+ stbi_idct_installed(z->img_comp[n].data+z->img_comp[n].w2*j*8+i*8, z->img_comp[n].w2, data, z->dequant2[z->img_comp[n].tq]);
+ #else
+ idct_block(z->img_comp[n].data+z->img_comp[n].w2*j*8+i*8, z->img_comp[n].w2, data, z->dequant[z->img_comp[n].tq]);
+ #endif
+ // every data block is an MCU, so countdown the restart interval
+ if (--z->todo <= 0) {
+ if (z->code_bits < 24) grow_buffer_unsafe(z);
+ // if it's NOT a restart, then just bail, so we get corrupt data
+ // rather than no data
+ if (!RESTART(z->marker)) return 1;
+ reset(z);
+ }
+ }
+ }
+ } else { // interleaved!
+ int i,j,k,x,y;
+ short data[64];
+ for (j=0; j < z->img_mcu_y; ++j) {
+ for (i=0; i < z->img_mcu_x; ++i) {
+ // scan an interleaved mcu... process scan_n components in order
+ for (k=0; k < z->scan_n; ++k) {
+ int n = z->order[k];
+ // scan out an mcu's worth of this component; that's just determined
+ // by the basic H and V specified for the component
+ for (y=0; y < z->img_comp[n].v; ++y) {
+ for (x=0; x < z->img_comp[n].h; ++x) {
+ int x2 = (i*z->img_comp[n].h + x)*8;
+ int y2 = (j*z->img_comp[n].v + y)*8;
+ if (!decode_block(z, data, z->huff_dc+z->img_comp[n].hd, z->huff_ac+z->img_comp[n].ha, n)) return 0;
+ #if STBI_SIMD
+ stbi_idct_installed(z->img_comp[n].data+z->img_comp[n].w2*y2+x2, z->img_comp[n].w2, data, z->dequant2[z->img_comp[n].tq]);
+ #else
+ idct_block(z->img_comp[n].data+z->img_comp[n].w2*y2+x2, z->img_comp[n].w2, data, z->dequant[z->img_comp[n].tq]);
+ #endif
+ }
+ }
+ }
+ // after all interleaved components, that's an interleaved MCU,
+ // so now count down the restart interval
+ if (--z->todo <= 0) {
+ if (z->code_bits < 24) grow_buffer_unsafe(z);
+ // if it's NOT a restart, then just bail, so we get corrupt data
+ // rather than no data
+ if (!RESTART(z->marker)) return 1;
+ reset(z);
+ }
+ }
+ }
+ }
+ return 1;
+}
+
+static int process_marker(jpeg *z, int m)
+{
+ int L;
+ switch (m) {
+ case MARKER_none: // no marker found
+ return e("expected marker","Corrupt JPEG");
+
+ case 0xC2: // SOF - progressive
+ return e("progressive jpeg","JPEG format not supported (progressive)");
+
+ case 0xDD: // DRI - specify restart interval
+ if (get16(&z->s) != 4) return e("bad DRI len","Corrupt JPEG");
+ z->restart_interval = get16(&z->s);
+ return 1;
+
+ case 0xDB: // DQT - define quantization table
+ L = get16(&z->s)-2;
+ while (L > 0) {
+ int q = get8(&z->s);
+ int p = q >> 4;
+ int t = q & 15,i;
+ if (p != 0) return e("bad DQT type","Corrupt JPEG");
+ if (t > 3) return e("bad DQT table","Corrupt JPEG");
+ for (i=0; i < 64; ++i)
+ z->dequant[t][dezigzag[i]] = get8u(&z->s);
+ #if STBI_SIMD
+ for (i=0; i < 64; ++i)
+ z->dequant2[t][i] = z->dequant[t][i];
+ #endif
+ L -= 65;
+ }
+ return L==0;
+
+ case 0xC4: // DHT - define huffman table
+ L = get16(&z->s)-2;
+ while (L > 0) {
+ uint8 *v;
+ int sizes[16],i,m=0;
+ int q = get8(&z->s);
+ int tc = q >> 4;
+ int th = q & 15;
+ if (tc > 1 || th > 3) return e("bad DHT header","Corrupt JPEG");
+ for (i=0; i < 16; ++i) {
+ sizes[i] = get8(&z->s);
+ m += sizes[i];
+ }
+ L -= 17;
+ if (tc == 0) {
+ if (!build_huffman(z->huff_dc+th, sizes)) return 0;
+ v = z->huff_dc[th].values;
+ } else {
+ if (!build_huffman(z->huff_ac+th, sizes)) return 0;
+ v = z->huff_ac[th].values;
+ }
+ for (i=0; i < m; ++i)
+ v[i] = get8u(&z->s);
+ L -= m;
+ }
+ return L==0;
+ }
+ // check for comment block or APP blocks
+ if ((m >= 0xE0 && m <= 0xEF) || m == 0xFE) {
+ skip(&z->s, get16(&z->s)-2);
+ return 1;
+ }
+ return 0;
+}
+
+// after we see SOS
+static int process_scan_header(jpeg *z)
+{
+ int i;
+ int Ls = get16(&z->s);
+ z->scan_n = get8(&z->s);
+ if (z->scan_n < 1 || z->scan_n > 4 || z->scan_n > (int) z->s.img_n) return e("bad SOS component count","Corrupt JPEG");
+ if (Ls != 6+2*z->scan_n) return e("bad SOS len","Corrupt JPEG");
+ for (i=0; i < z->scan_n; ++i) {
+ int id = get8(&z->s), which;
+ int q = get8(&z->s);
+ for (which = 0; which < z->s.img_n; ++which)
+ if (z->img_comp[which].id == id)
+ break;
+ if (which == z->s.img_n) return 0;
+ z->img_comp[which].hd = q >> 4; if (z->img_comp[which].hd > 3) return e("bad DC huff","Corrupt JPEG");
+ z->img_comp[which].ha = q & 15; if (z->img_comp[which].ha > 3) return e("bad AC huff","Corrupt JPEG");
+ z->order[i] = which;
+ }
+ if (get8(&z->s) != 0) return e("bad SOS","Corrupt JPEG");
+ get8(&z->s); // should be 63, but might be 0
+ if (get8(&z->s) != 0) return e("bad SOS","Corrupt JPEG");
+
+ return 1;
+}
+
+static int process_frame_header(jpeg *z, int scan)
+{
+ stbi *s = &z->s;
+ int Lf,p,i,q, h_max=1,v_max=1,c;
+ Lf = get16(s); if (Lf < 11) return e("bad SOF len","Corrupt JPEG"); // JPEG
+ p = get8(s); if (p != 8) return e("only 8-bit","JPEG format not supported: 8-bit only"); // JPEG baseline
+ s->img_y = get16(s); if (s->img_y == 0) return e("no header height", "JPEG format not supported: delayed height"); // Legal, but we don't handle it--but neither does IJG
+ s->img_x = get16(s); if (s->img_x == 0) return e("0 width","Corrupt JPEG"); // JPEG requires
+ c = get8(s);
+ if (c != 3 && c != 1) return e("bad component count","Corrupt JPEG"); // JFIF requires
+ s->img_n = c;
+ for (i=0; i < c; ++i) {
+ z->img_comp[i].data = NULL;
+ z->img_comp[i].linebuf = NULL;
+ }
+
+ if (Lf != 8+3*s->img_n) return e("bad SOF len","Corrupt JPEG");
+
+ for (i=0; i < s->img_n; ++i) {
+ z->img_comp[i].id = get8(s);
+ if (z->img_comp[i].id != i+1) // JFIF requires
+ if (z->img_comp[i].id != i) // some version of jpegtran outputs non-JFIF-compliant files!
+ return e("bad component ID","Corrupt JPEG");
+ q = get8(s);
+ z->img_comp[i].h = (q >> 4); if (!z->img_comp[i].h || z->img_comp[i].h > 4) return e("bad H","Corrupt JPEG");
+ z->img_comp[i].v = q & 15; if (!z->img_comp[i].v || z->img_comp[i].v > 4) return e("bad V","Corrupt JPEG");
+ z->img_comp[i].tq = get8(s); if (z->img_comp[i].tq > 3) return e("bad TQ","Corrupt JPEG");
+ }
+
+ if (scan != SCAN_load) return 1;
+
+ if ((1 << 30) / s->img_x / s->img_n < s->img_y) return e("too large", "Image too large to decode");
+
+ for (i=0; i < s->img_n; ++i) {
+ if (z->img_comp[i].h > h_max) h_max = z->img_comp[i].h;
+ if (z->img_comp[i].v > v_max) v_max = z->img_comp[i].v;
+ }
+
+ // compute interleaved mcu info
+ z->img_h_max = h_max;
+ z->img_v_max = v_max;
+ z->img_mcu_w = h_max * 8;
+ z->img_mcu_h = v_max * 8;
+ z->img_mcu_x = (s->img_x + z->img_mcu_w-1) / z->img_mcu_w;
+ z->img_mcu_y = (s->img_y + z->img_mcu_h-1) / z->img_mcu_h;
+
+ for (i=0; i < s->img_n; ++i) {
+ // number of effective pixels (e.g. for non-interleaved MCU)
+ z->img_comp[i].x = (s->img_x * z->img_comp[i].h + h_max-1) / h_max;
+ z->img_comp[i].y = (s->img_y * z->img_comp[i].v + v_max-1) / v_max;
+ // to simplify generation, we'll allocate enough memory to decode
+ // the bogus oversized data from using interleaved MCUs and their
+ // big blocks (e.g. a 16x16 iMCU on an image of width 33); we won't
+ // discard the extra data until colorspace conversion
+ z->img_comp[i].w2 = z->img_mcu_x * z->img_comp[i].h * 8;
+ z->img_comp[i].h2 = z->img_mcu_y * z->img_comp[i].v * 8;
+ z->img_comp[i].raw_data = malloc(z->img_comp[i].w2 * z->img_comp[i].h2+15);
+ if (z->img_comp[i].raw_data == NULL) {
+ for(--i; i >= 0; --i) {
+ free(z->img_comp[i].raw_data);
+ z->img_comp[i].data = NULL;
+ }
+ return e("outofmem", "Out of memory");
+ }
+ // align blocks for installable-idct using mmx/sse
+ z->img_comp[i].data = (uint8*) (((size_t) z->img_comp[i].raw_data + 15) & ~15);
+ z->img_comp[i].linebuf = NULL;
+ }
+
+ return 1;
+}
+
+// use comparisons since in some cases we handle more than one case (e.g. SOF)
+#define DNL(x) ((x) == 0xdc)
+#define SOI(x) ((x) == 0xd8)
+#define EOI(x) ((x) == 0xd9)
+#define SOF(x) ((x) == 0xc0 || (x) == 0xc1)
+#define SOS(x) ((x) == 0xda)
+
+static int decode_jpeg_header(jpeg *z, int scan)
+{
+ int m;
+ z->marker = MARKER_none; // initialize cached marker to empty
+ m = get_marker(z);
+ if (!SOI(m)) return e("no SOI","Corrupt JPEG");
+ if (scan == SCAN_type) return 1;
+ m = get_marker(z);
+ while (!SOF(m)) {
+ if (!process_marker(z,m)) return 0;
+ m = get_marker(z);
+ while (m == MARKER_none) {
+ // some files have extra padding after their blocks, so ok, we'll scan
+ if (at_eof(&z->s)) return e("no SOF", "Corrupt JPEG");
+ m = get_marker(z);
+ }
+ }
+ if (!process_frame_header(z, scan)) return 0;
+ return 1;
+}
+
+static int decode_jpeg_image(jpeg *j)
+{
+ int m;
+ j->restart_interval = 0;
+ if (!decode_jpeg_header(j, SCAN_load)) return 0;
+ m = get_marker(j);
+ while (!EOI(m)) {
+ if (SOS(m)) {
+ if (!process_scan_header(j)) return 0;
+ if (!parse_entropy_coded_data(j)) return 0;
+ } else {
+ if (!process_marker(j, m)) return 0;
+ }
+ m = get_marker(j);
+ }
+ return 1;
+}
+
+// static jfif-centered resampling (across block boundaries)
+
+typedef uint8 *(*resample_row_func)(uint8 *out, uint8 *in0, uint8 *in1,
+ int w, int hs);
+
+#define div4(x) ((uint8) ((x) >> 2))
+
+static uint8 *resample_row_1(uint8 * /*out*/, uint8 *in_near, uint8 * /*in_far*/, int /*w*/, int /*hs*/)
+{
+ return in_near;
+}
+
+static uint8* resample_row_v_2(uint8 *out, uint8 *in_near, uint8 * in_far, int w, int /*hs*/)
+{
+ // need to generate two samples vertically for every one in input
+ int i;
+ for (i=0; i < w; ++i)
+ out[i] = div4(3*in_near[i] + in_far[i] + 2);
+ return out;
+}
+
+static uint8* resample_row_h_2(uint8 *out, uint8 *in_near, uint8 * /*in_far*/, int w, int /*hs*/)
+{
+ // need to generate two samples horizontally for every one in input
+ int i;
+ uint8 *input = in_near;
+ if (w == 1) {
+ // if only one sample, can't do any interpolation
+ out[0] = out[1] = input[0];
+ return out;
+ }
+
+ out[0] = input[0];
+ out[1] = div4(input[0]*3 + input[1] + 2);
+ for (i=1; i < w-1; ++i) {
+ int n = 3*input[i]+2;
+ out[i*2+0] = div4(n+input[i-1]);
+ out[i*2+1] = div4(n+input[i+1]);
+ }
+ out[i*2+0] = div4(input[w-2]*3 + input[w-1] + 2);
+ out[i*2+1] = input[w-1];
+ return out;
+}
+
+#define div16(x) ((uint8) ((x) >> 4))
+
+static uint8 *resample_row_hv_2(uint8 *out, uint8 *in_near, uint8 *in_far, int w, int /*hs*/)
+{
+ // need to generate 2x2 samples for every one in input
+ int i,t0,t1;
+ if (w == 1) {
+ out[0] = out[1] = div4(3*in_near[0] + in_far[0] + 2);
+ return out;
+ }
+
+ t1 = 3*in_near[0] + in_far[0];
+ out[0] = div4(t1+2);
+ for (i=1; i < w; ++i) {
+ t0 = t1;
+ t1 = 3*in_near[i]+in_far[i];
+ out[i*2-1] = div16(3*t0 + t1 + 8);
+ out[i*2 ] = div16(3*t1 + t0 + 8);
+ }
+ out[w*2-1] = div4(t1+2);
+ return out;
+}
+
+static uint8 *resample_row_generic(uint8 *out, uint8 *in_near, uint8 * /*in_far*/, int w, int hs)
+{
+ // resample with nearest-neighbor
+ int i,j;
+ for (i=0; i < w; ++i)
+ for (j=0; j < hs; ++j)
+ out[i*hs+j] = in_near[i];
+ return out;
+}
+
+#define float2fixed(x) ((int) ((x) * 65536 + 0.5))
+
+// 0.38 seconds on 3*anemones.jpg (0.25 with processor = Pro)
+// VC6 without processor=Pro is generating multiple LEAs per multiply!
+static void YCbCr_to_RGB_row(uint8 *out, const uint8 *y, const uint8 *pcb, const uint8 *pcr, int count, int step)
+{
+ int i;
+ for (i=0; i < count; ++i) {
+ int y_fixed = (y[i] << 16) + 32768; // rounding
+ int r,g,b;
+ int cr = pcr[i] - 128;
+ int cb = pcb[i] - 128;
+ r = y_fixed + cr*float2fixed(1.40200f);
+ g = y_fixed - cr*float2fixed(0.71414f) - cb*float2fixed(0.34414f);
+ b = y_fixed + cb*float2fixed(1.77200f);
+ r >>= 16;
+ g >>= 16;
+ b >>= 16;
+ if ((unsigned) r > 255) { if (r < 0) r = 0; else r = 255; }
+ if ((unsigned) g > 255) { if (g < 0) g = 0; else g = 255; }
+ if ((unsigned) b > 255) { if (b < 0) b = 0; else b = 255; }
+ out[0] = (uint8)r;
+ out[1] = (uint8)g;
+ out[2] = (uint8)b;
+ out[3] = 255;
+ out += step;
+ }
+}
+
+#if STBI_SIMD
+static stbi_YCbCr_to_RGB_run stbi_YCbCr_installed = YCbCr_to_RGB_row;
+
+void stbi_install_YCbCr_to_RGB(stbi_YCbCr_to_RGB_run func)
+{
+ stbi_YCbCr_installed = func;
+}
+#endif
+
+
+// clean up the temporary component buffers
+static void cleanup_jpeg(jpeg *j)
+{
+ int i;
+ for (i=0; i < j->s.img_n; ++i) {
+ if (j->img_comp[i].data) {
+ free(j->img_comp[i].raw_data);
+ j->img_comp[i].data = NULL;
+ }
+ if (j->img_comp[i].linebuf) {
+ free(j->img_comp[i].linebuf);
+ j->img_comp[i].linebuf = NULL;
+ }
+ }
+}
+
+typedef struct
+{
+ resample_row_func resample;
+ uint8 *line0,*line1;
+ int hs,vs; // expansion factor in each axis
+ int w_lores; // horizontal pixels pre-expansion
+ int ystep; // how far through vertical expansion we are
+ int ypos; // which pre-expansion row we're on
+} stbi_resample;
+
+static uint8 *load_jpeg_image(jpeg *z, int *out_x, int *out_y, int *comp, int req_comp)
+{
+ int n, decode_n;
+ // validate req_comp
+ if (req_comp < 0 || req_comp > 4) return epuc("bad req_comp", "Internal error");
+ z->s.img_n = 0;
+
+ // load a jpeg image from whichever source
+ if (!decode_jpeg_image(z)) { cleanup_jpeg(z); return NULL; }
+
+ // determine actual number of components to generate
+ n = req_comp ? req_comp : z->s.img_n;
+
+ if (z->s.img_n == 3 && n < 3)
+ decode_n = 1;
+ else
+ decode_n = z->s.img_n;
+
+ // resample and color-convert
+ {
+ int k;
+ uint i,j;
+ uint8 *output;
+ uint8 *coutput[4];
+
+ stbi_resample res_comp[4];
+
+ for (k=0; k < decode_n; ++k) {
+ stbi_resample *r = &res_comp[k];
+
+ // allocate line buffer big enough for upsampling off the edges
+ // with upsample factor of 4
+ z->img_comp[k].linebuf = (uint8 *) malloc(z->s.img_x + 3);
+ if (!z->img_comp[k].linebuf) { cleanup_jpeg(z); return epuc("outofmem", "Out of memory"); }
+
+ r->hs = z->img_h_max / z->img_comp[k].h;
+ r->vs = z->img_v_max / z->img_comp[k].v;
+ r->ystep = r->vs >> 1;
+ r->w_lores = (z->s.img_x + r->hs-1) / r->hs;
+ r->ypos = 0;
+ r->line0 = r->line1 = z->img_comp[k].data;
+
+ if (r->hs == 1 && r->vs == 1) r->resample = resample_row_1;
+ else if (r->hs == 1 && r->vs == 2) r->resample = resample_row_v_2;
+ else if (r->hs == 2 && r->vs == 1) r->resample = resample_row_h_2;
+ else if (r->hs == 2 && r->vs == 2) r->resample = resample_row_hv_2;
+ else r->resample = resample_row_generic;
+ }
+
+ // can't error after this so, this is safe
+ output = (uint8 *) malloc(n * z->s.img_x * z->s.img_y + 1);
+ if (!output) { cleanup_jpeg(z); return epuc("outofmem", "Out of memory"); }
+
+ // now go ahead and resample
+ for (j=0; j < z->s.img_y; ++j) {
+ uint8 *out = output + n * z->s.img_x * j;
+ for (k=0; k < decode_n; ++k) {
+ stbi_resample *r = &res_comp[k];
+ int y_bot = r->ystep >= (r->vs >> 1);
+ coutput[k] = r->resample(z->img_comp[k].linebuf,
+ y_bot ? r->line1 : r->line0,
+ y_bot ? r->line0 : r->line1,
+ r->w_lores, r->hs);
+ if (++r->ystep >= r->vs) {
+ r->ystep = 0;
+ r->line0 = r->line1;
+ if (++r->ypos < z->img_comp[k].y)
+ r->line1 += z->img_comp[k].w2;
+ }
+ }
+ if (n >= 3) {
+ uint8 *y = coutput[0];
+ if (z->s.img_n == 3) {
+ #if STBI_SIMD
+ stbi_YCbCr_installed(out, y, coutput[1], coutput[2], z->s.img_x, n);
+ #else
+ YCbCr_to_RGB_row(out, y, coutput[1], coutput[2], z->s.img_x, n);
+ #endif
+ } else
+ for (i=0; i < z->s.img_x; ++i) {
+ out[0] = out[1] = out[2] = y[i];
+ out[3] = 255; // not used if n==3
+ out += n;
+ }
+ } else {
+ uint8 *y = coutput[0];
+ if (n == 1)
+ for (i=0; i < z->s.img_x; ++i) out[i] = y[i];
+ else
+ for (i=0; i < z->s.img_x; ++i) *out++ = y[i], *out++ = 255;
+ }
+ }
+ cleanup_jpeg(z);
+ *out_x = z->s.img_x;
+ *out_y = z->s.img_y;
+ if (comp) *comp = z->s.img_n; // report original components, not output
+ return output;
+ }
+}
+
+#ifndef STBI_NO_STDIO
+unsigned char *stbi_jpeg_load_from_file(FILE *f, int *x, int *y, int *comp, int req_comp)
+{
+ jpeg j;
+ start_file(&j.s, f);
+ return load_jpeg_image(&j, x,y,comp,req_comp);
+}
+
+unsigned char *stbi_jpeg_load(char const *filename, int *x, int *y, int *comp, int req_comp)
+{
+ unsigned char *data;
+ FILE *f = fopen(filename, "rb");
+ if (!f) return NULL;
+ data = stbi_jpeg_load_from_file(f,x,y,comp,req_comp);
+ fclose(f);
+ return data;
+}
+#endif
+
+unsigned char *stbi_jpeg_load_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp)
+{
+ jpeg j;
+ start_mem(&j.s, buffer,len);
+ return load_jpeg_image(&j, x,y,comp,req_comp);
+}
+
+#ifndef STBI_NO_STDIO
+int stbi_jpeg_test_file(FILE *f)
+{
+ int n,r;
+ jpeg j;
+ n = ftell(f);
+ start_file(&j.s, f);
+ r = decode_jpeg_header(&j, SCAN_type);
+ fseek(f,n,SEEK_SET);
+ return r;
+}
+#endif
+
+int stbi_jpeg_test_memory(stbi_uc const *buffer, int len)
+{
+ jpeg j;
+ start_mem(&j.s, buffer,len);
+ return decode_jpeg_header(&j, SCAN_type);
+}
+
+// @TODO:
+#ifndef STBI_NO_STDIO
+extern int stbi_jpeg_info (char const *filename, int *x, int *y, int *comp);
+extern int stbi_jpeg_info_from_file (FILE *f, int *x, int *y, int *comp);
+#endif
+extern int stbi_jpeg_info_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp);
+
+// public domain zlib decode v0.2 Sean Barrett 2006-11-18
+// simple implementation
+// - all input must be provided in an upfront buffer
+// - all output is written to a single output buffer (can malloc/realloc)
+// performance
+// - fast huffman
+
+// fast-way is faster to check than jpeg huffman, but slow way is slower
+#define ZFAST_BITS 9 // accelerate all cases in default tables
+#define ZFAST_MASK ((1 << ZFAST_BITS) - 1)
+
+// zlib-style huffman encoding
+// (jpegs packs from left, zlib from right, so can't share code)
+typedef struct
+{
+ uint16 fast[1 << ZFAST_BITS];
+ uint16 firstcode[16];
+ int maxcode[17];
+ uint16 firstsymbol[16];
+ uint8 size[288];
+ uint16 value[288];
+} zhuffman;
+
+__forceinline static int bitreverse16(int n)
+{
+ n = ((n & 0xAAAA) >> 1) | ((n & 0x5555) << 1);
+ n = ((n & 0xCCCC) >> 2) | ((n & 0x3333) << 2);
+ n = ((n & 0xF0F0) >> 4) | ((n & 0x0F0F) << 4);
+ n = ((n & 0xFF00) >> 8) | ((n & 0x00FF) << 8);
+ return n;
+}
+
+__forceinline static int bit_reverse(int v, int bits)
+{
+ assert(bits <= 16);
+ // to bit reverse n bits, reverse 16 and shift
+ // e.g. 11 bits, bit reverse and shift away 5
+ return bitreverse16(v) >> (16-bits);
+}
+
+static int zbuild_huffman(zhuffman *z, uint8 *sizelist, int num)
+{
+ int i,k=0;
+ int code, next_code[16], sizes[17];
+
+ // DEFLATE spec for generating codes
+ memset(sizes, 0, sizeof(sizes));
+ memset(z->fast, 255, sizeof(z->fast));
+ for (i=0; i < num; ++i)
+ ++sizes[sizelist[i]];
+ sizes[0] = 0;
+ for (i=1; i < 16; ++i)
+ assert(sizes[i] <= (1 << i));
+ code = 0;
+ for (i=1; i < 16; ++i) {
+ next_code[i] = code;
+ z->firstcode[i] = (uint16) code;
+ z->firstsymbol[i] = (uint16) k;
+ code = (code + sizes[i]);
+ if (sizes[i])
+ if (code-1 >= (1 << i)) return e("bad codelengths","Corrupt JPEG");
+ z->maxcode[i] = code << (16-i); // preshift for inner loop
+ code <<= 1;
+ k += sizes[i];
+ }
+ z->maxcode[16] = 0x10000; // sentinel
+ for (i=0; i < num; ++i) {
+ int s = sizelist[i];
+ if (s) {
+ int c = next_code[s] - z->firstcode[s] + z->firstsymbol[s];
+ z->size[c] = (uint8)s;
+ z->value[c] = (uint16)i;
+ if (s <= ZFAST_BITS) {
+ int k = bit_reverse(next_code[s],s);
+ while (k < (1 << ZFAST_BITS)) {
+ z->fast[k] = (uint16) c;
+ k += (1 << s);
+ }
+ }
+ ++next_code[s];
+ }
+ }
+ return 1;
+}
+
+// zlib-from-memory implementation for PNG reading
+// because PNG allows splitting the zlib stream arbitrarily,
+// and it's annoying structurally to have PNG call ZLIB call PNG,
+// we require PNG read all the IDATs and combine them into a single
+// memory buffer
+
+typedef struct
+{
+ uint8 *zbuffer, *zbuffer_end;
+ int num_bits;
+ uint32 code_buffer;
+
+ char *zout;
+ char *zout_start;
+ char *zout_end;
+ int z_expandable;
+
+ zhuffman z_length, z_distance;
+} zbuf;
+
+__forceinline static int zget8(zbuf *z)
+{
+ if (z->zbuffer >= z->zbuffer_end) return 0;
+ return *z->zbuffer++;
+}
+
+static void fill_bits(zbuf *z)
+{
+ do {
+ assert(z->code_buffer < (1U << z->num_bits));
+ z->code_buffer |= zget8(z) << z->num_bits;
+ z->num_bits += 8;
+ } while (z->num_bits <= 24);
+}
+
+__forceinline static unsigned int zreceive(zbuf *z, int n)
+{
+ unsigned int k;
+ if (z->num_bits < n) fill_bits(z);
+ k = z->code_buffer & ((1 << n) - 1);
+ z->code_buffer >>= n;
+ z->num_bits -= n;
+ return k;
+}
+
+__forceinline static int zhuffman_decode(zbuf *a, zhuffman *z)
+{
+ int b,s,k;
+ if (a->num_bits < 16) fill_bits(a);
+ b = z->fast[a->code_buffer & ZFAST_MASK];
+ if (b < 0xffff) {
+ s = z->size[b];
+ a->code_buffer >>= s;
+ a->num_bits -= s;
+ return z->value[b];
+ }
+
+ // not resolved by fast table, so compute it the slow way
+ // use jpeg approach, which requires MSbits at top
+ k = bit_reverse(a->code_buffer, 16);
+ for (s=ZFAST_BITS+1; ; ++s)
+ if (k < z->maxcode[s])
+ break;
+ if (s == 16) return -1; // invalid code!
+ // code size is s, so:
+ b = (k >> (16-s)) - z->firstcode[s] + z->firstsymbol[s];
+ assert(z->size[b] == s);
+ a->code_buffer >>= s;
+ a->num_bits -= s;
+ return z->value[b];
+}
+
+static int expand(zbuf *z, int n) // need to make room for n bytes
+{
+ char *q;
+ int cur, limit;
+ if (!z->z_expandable) return e("output buffer limit","Corrupt PNG");
+ cur = (int) (z->zout - z->zout_start);
+ limit = (int) (z->zout_end - z->zout_start);
+ while (cur + n > limit)
+ limit *= 2;
+ q = (char *) realloc(z->zout_start, limit);
+ if (q == NULL) return e("outofmem", "Out of memory");
+ z->zout_start = q;
+ z->zout = q + cur;
+ z->zout_end = q + limit;
+ return 1;
+}
+
+static int length_base[31] = {
+ 3,4,5,6,7,8,9,10,11,13,
+ 15,17,19,23,27,31,35,43,51,59,
+ 67,83,99,115,131,163,195,227,258,0,0 };
+
+static int length_extra[31]=
+{ 0,0,0,0,0,0,0,0,1,1,1,1,2,2,2,2,3,3,3,3,4,4,4,4,5,5,5,5,0,0,0 };
+
+static int dist_base[32] = { 1,2,3,4,5,7,9,13,17,25,33,49,65,97,129,193,
+257,385,513,769,1025,1537,2049,3073,4097,6145,8193,12289,16385,24577,0,0};
+
+static int dist_extra[32] =
+{ 0,0,0,0,1,1,2,2,3,3,4,4,5,5,6,6,7,7,8,8,9,9,10,10,11,11,12,12,13,13};
+
+static int parse_huffman_block(zbuf *a)
+{
+ for(;;) {
+ int z = zhuffman_decode(a, &a->z_length);
+ if (z < 256) {
+ if (z < 0) return e("bad huffman code","Corrupt PNG"); // error in huffman codes
+ if (a->zout >= a->zout_end) if (!expand(a, 1)) return 0;
+ *a->zout++ = (char) z;
+ } else {
+ uint8 *p;
+ int len,dist;
+ if (z == 256) return 1;
+ z -= 257;
+ len = length_base[z];
+ if (length_extra[z]) len += zreceive(a, length_extra[z]);
+ z = zhuffman_decode(a, &a->z_distance);
+ if (z < 0) return e("bad huffman code","Corrupt PNG");
+ dist = dist_base[z];
+ if (dist_extra[z]) dist += zreceive(a, dist_extra[z]);
+ if (a->zout - a->zout_start < dist) return e("bad dist","Corrupt PNG");
+ if (a->zout + len > a->zout_end) if (!expand(a, len)) return 0;
+ p = (uint8 *) (a->zout - dist);
+ while (len--)
+ *a->zout++ = *p++;
+ }
+ }
+}
+
+static int compute_huffman_codes(zbuf *a)
+{
+ static uint8 length_dezigzag[19] = { 16,17,18,0,8,7,9,6,10,5,11,4,12,3,13,2,14,1,15 };
+ zhuffman z_codelength;
+ uint8 lencodes[286+32+137];//padding for maximum single op
+ uint8 codelength_sizes[19];
+ int i,n;
+
+ int hlit = zreceive(a,5) + 257;
+ int hdist = zreceive(a,5) + 1;
+ int hclen = zreceive(a,4) + 4;
+
+ memset(codelength_sizes, 0, sizeof(codelength_sizes));
+ for (i=0; i < hclen; ++i) {
+ int s = zreceive(a,3);
+ codelength_sizes[length_dezigzag[i]] = (uint8) s;
+ }
+ if (!zbuild_huffman(&z_codelength, codelength_sizes, 19)) return 0;
+
+ n = 0;
+ while (n < hlit + hdist) {
+ int c = zhuffman_decode(a, &z_codelength);
+ assert(c >= 0 && c < 19);
+ if (c < 16)
+ lencodes[n++] = (uint8) c;
+ else if (c == 16) {
+ c = zreceive(a,2)+3;
+ memset(lencodes+n, lencodes[n-1], c);
+ n += c;
+ } else if (c == 17) {
+ c = zreceive(a,3)+3;
+ memset(lencodes+n, 0, c);
+ n += c;
+ } else {
+ assert(c == 18);
+ c = zreceive(a,7)+11;
+ memset(lencodes+n, 0, c);
+ n += c;
+ }
+ }
+ if (n != hlit+hdist) return e("bad codelengths","Corrupt PNG");
+ if (!zbuild_huffman(&a->z_length, lencodes, hlit)) return 0;
+ if (!zbuild_huffman(&a->z_distance, lencodes+hlit, hdist)) return 0;
+ return 1;
+}
+
+static int parse_uncompressed_block(zbuf *a)
+{
+ uint8 header[4];
+ int len,nlen,k;
+ if (a->num_bits & 7)
+ zreceive(a, a->num_bits & 7); // discard
+ // drain the bit-packed data into header
+ k = 0;
+ while (a->num_bits > 0) {
+ header[k++] = (uint8) (a->code_buffer & 255); // wtf this warns?
+ a->code_buffer >>= 8;
+ a->num_bits -= 8;
+ }
+ assert(a->num_bits == 0);
+ // now fill header the normal way
+ while (k < 4)
+ header[k++] = (uint8) zget8(a);
+ len = header[1] * 256 + header[0];
+ nlen = header[3] * 256 + header[2];
+ if (nlen != (len ^ 0xffff)) return e("zlib corrupt","Corrupt PNG");
+ if (a->zbuffer + len > a->zbuffer_end) return e("read past buffer","Corrupt PNG");
+ if (a->zout + len > a->zout_end)
+ if (!expand(a, len)) return 0;
+ memcpy(a->zout, a->zbuffer, len);
+ a->zbuffer += len;
+ a->zout += len;
+ return 1;
+}
+
+static int parse_zlib_header(zbuf *a)
+{
+ int cmf = zget8(a);
+ int cm = cmf & 15;
+ /* int cinfo = cmf >> 4; */
+ int flg = zget8(a);
+ if ((cmf*256+flg) % 31 != 0) return e("bad zlib header","Corrupt PNG"); // zlib spec
+ if (flg & 32) return e("no preset dict","Corrupt PNG"); // preset dictionary not allowed in png
+ if (cm != 8) return e("bad compression","Corrupt PNG"); // DEFLATE required for png
+ // window = 1 << (8 + cinfo)... but who cares, we fully buffer output
+ return 1;
+}
+
+// @TODO: should statically initialize these for optimal thread safety
+static uint8 default_length[288], default_distance[32];
+static void init_defaults(void)
+{
+ int i; // use <= to match clearly with spec
+ for (i=0; i <= 143; ++i) default_length[i] = 8;
+ for ( ; i <= 255; ++i) default_length[i] = 9;
+ for ( ; i <= 279; ++i) default_length[i] = 7;
+ for ( ; i <= 287; ++i) default_length[i] = 8;
+
+ for (i=0; i <= 31; ++i) default_distance[i] = 5;
+}
+
+int stbi_png_partial; // a quick hack to only allow decoding some of a PNG... I should implement real streaming support instead
+static int parse_zlib(zbuf *a, int parse_header)
+{
+ int final, type;
+ if (parse_header)
+ if (!parse_zlib_header(a)) return 0;
+ a->num_bits = 0;
+ a->code_buffer = 0;
+ do {
+ final = zreceive(a,1);
+ type = zreceive(a,2);
+ if (type == 0) {
+ if (!parse_uncompressed_block(a)) return 0;
+ } else if (type == 3) {
+ return 0;
+ } else {
+ if (type == 1) {
+ // use fixed code lengths
+ if (!default_distance[31]) init_defaults();
+ if (!zbuild_huffman(&a->z_length , default_length , 288)) return 0;
+ if (!zbuild_huffman(&a->z_distance, default_distance, 32)) return 0;
+ } else {
+ if (!compute_huffman_codes(a)) return 0;
+ }
+ if (!parse_huffman_block(a)) return 0;
+ }
+ if (stbi_png_partial && a->zout - a->zout_start > 65536)
+ break;
+ } while (!final);
+ return 1;
+}
+
+static int do_zlib(zbuf *a, char *obuf, int olen, int exp, int parse_header)
+{
+ a->zout_start = obuf;
+ a->zout = obuf;
+ a->zout_end = obuf + olen;
+ a->z_expandable = exp;
+
+ return parse_zlib(a, parse_header);
+}
+
+char *stbi_zlib_decode_malloc_guesssize(const char *buffer, int len, int initial_size, int *outlen)
+{
+ zbuf a;
+ char *p = (char *) malloc(initial_size);
+ if (p == NULL) return NULL;
+ a.zbuffer = (uint8 *) buffer;
+ a.zbuffer_end = (uint8 *) buffer + len;
+ if (do_zlib(&a, p, initial_size, 1, 1)) {
+ if (outlen) *outlen = (int) (a.zout - a.zout_start);
+ return a.zout_start;
+ } else {
+ free(a.zout_start);
+ return NULL;
+ }
+}
+
+char *stbi_zlib_decode_malloc(char const *buffer, int len, int *outlen)
+{
+ return stbi_zlib_decode_malloc_guesssize(buffer, len, 16384, outlen);
+}
+
+int stbi_zlib_decode_buffer(char *obuffer, int olen, char const *ibuffer, int ilen)
+{
+ zbuf a;
+ a.zbuffer = (uint8 *) ibuffer;
+ a.zbuffer_end = (uint8 *) ibuffer + ilen;
+ if (do_zlib(&a, obuffer, olen, 0, 1))
+ return (int) (a.zout - a.zout_start);
+ else
+ return -1;
+}
+
+char *stbi_zlib_decode_noheader_malloc(char const *buffer, int len, int *outlen)
+{
+ zbuf a;
+ char *p = (char *) malloc(16384);
+ if (p == NULL) return NULL;
+ a.zbuffer = (uint8 *) buffer;
+ a.zbuffer_end = (uint8 *) buffer+len;
+ if (do_zlib(&a, p, 16384, 1, 0)) {
+ if (outlen) *outlen = (int) (a.zout - a.zout_start);
+ return a.zout_start;
+ } else {
+ free(a.zout_start);
+ return NULL;
+ }
+}
+
+int stbi_zlib_decode_noheader_buffer(char *obuffer, int olen, const char *ibuffer, int ilen)
+{
+ zbuf a;
+ a.zbuffer = (uint8 *) ibuffer;
+ a.zbuffer_end = (uint8 *) ibuffer + ilen;
+ if (do_zlib(&a, obuffer, olen, 0, 0))
+ return (int) (a.zout - a.zout_start);
+ else
+ return -1;
+}
+
+// public domain "baseline" PNG decoder v0.10 Sean Barrett 2006-11-18
+// simple implementation
+// - only 8-bit samples
+// - no CRC checking
+// - allocates lots of intermediate memory
+// - avoids problem of streaming data between subsystems
+// - avoids explicit window management
+// performance
+// - uses stb_zlib, a PD zlib implementation with fast huffman decoding
+
+
+typedef struct
+{
+ uint32 length;
+ uint32 type;
+} chunk;
+
+#define PNG_TYPE(a,b,c,d) (((a) << 24) + ((b) << 16) + ((c) << 8) + (d))
+
+static chunk get_chunk_header(stbi *s)
+{
+ chunk c;
+ c.length = get32(s);
+ c.type = get32(s);
+ return c;
+}
+
+static int check_png_header(stbi *s)
+{
+ static uint8 png_sig[8] = { 137,80,78,71,13,10,26,10 };
+ int i;
+ for (i=0; i < 8; ++i)
+ if (get8(s) != png_sig[i]) return e("bad png sig","Not a PNG");
+ return 1;
+}
+
+typedef struct
+{
+ stbi s;
+ uint8 *idata, *expanded, *out;
+} png;
+
+
+enum {
+ F_none=0, F_sub=1, F_up=2, F_avg=3, F_paeth=4,
+ F_avg_first, F_paeth_first,
+};
+
+static uint8 first_row_filter[5] =
+{
+ F_none, F_sub, F_none, F_avg_first, F_paeth_first
+};
+
+static int paeth(int a, int b, int c)
+{
+ int p = a + b - c;
+ int pa = abs(p-a);
+ int pb = abs(p-b);
+ int pc = abs(p-c);
+ if (pa <= pb && pa <= pc) return a;
+ if (pb <= pc) return b;
+ return c;
+}
+
+// create the png data from post-deflated data
+static int create_png_image_raw(png *a, uint8 *raw, uint32 raw_len, int out_n, uint32 x, uint32 y)
+{
+ stbi *s = &a->s;
+ uint32 i,j,stride = x*out_n;
+ int k;
+ int img_n = s->img_n; // copy it into a local for later
+ assert(out_n == s->img_n || out_n == s->img_n+1);
+ if (stbi_png_partial) y = 1;
+ a->out = (uint8 *) malloc(x * y * out_n);
+ if (!a->out) return e("outofmem", "Out of memory");
+ if (!stbi_png_partial) {
+ if (s->img_x == x && s->img_y == y)
+ if (raw_len != (img_n * x + 1) * y) return e("not enough pixels","Corrupt PNG");
+ else // interlaced:
+ if (raw_len < (img_n * x + 1) * y) return e("not enough pixels","Corrupt PNG");
+ }
+ for (j=0; j < y; ++j) {
+ uint8 *cur = a->out + stride*j;
+ uint8 *prior = cur - stride;
+ int filter = *raw++;
+ if (filter > 4) return e("invalid filter","Corrupt PNG");
+ // if first row, use special filter that doesn't sample previous row
+ if (j == 0) filter = first_row_filter[filter];
+ // handle first pixel explicitly
+ for (k=0; k < img_n; ++k) {
+ switch(filter) {
+ case F_none : cur[k] = raw[k]; break;
+ case F_sub : cur[k] = raw[k]; break;
+ case F_up : cur[k] = raw[k] + prior[k]; break;
+ case F_avg : cur[k] = raw[k] + (prior[k]>>1); break;
+ case F_paeth : cur[k] = (uint8) (raw[k] + paeth(0,prior[k],0)); break;
+ case F_avg_first : cur[k] = raw[k]; break;
+ case F_paeth_first: cur[k] = raw[k]; break;
+ }
+ }
+ if (img_n != out_n) cur[img_n] = 255;
+ raw += img_n;
+ cur += out_n;
+ prior += out_n;
+ // this is a little gross, so that we don't switch per-pixel or per-component
+ if (img_n == out_n) {
+ #define CASE(f) \
+ case f: \
+ for (i=x-1; i >= 1; --i, raw+=img_n,cur+=img_n,prior+=img_n) \
+ for (k=0; k < img_n; ++k)
+ switch(filter) {
+ CASE(F_none) cur[k] = raw[k]; break;
+ CASE(F_sub) cur[k] = raw[k] + cur[k-img_n]; break;
+ CASE(F_up) cur[k] = raw[k] + prior[k]; break;
+ CASE(F_avg) cur[k] = raw[k] + ((prior[k] + cur[k-img_n])>>1); break;
+ CASE(F_paeth) cur[k] = (uint8) (raw[k] + paeth(cur[k-img_n],prior[k],prior[k-img_n])); break;
+ CASE(F_avg_first) cur[k] = raw[k] + (cur[k-img_n] >> 1); break;
+ CASE(F_paeth_first) cur[k] = (uint8) (raw[k] + paeth(cur[k-img_n],0,0)); break;
+ }
+ #undef CASE
+ } else {
+ assert(img_n+1 == out_n);
+ #define CASE(f) \
+ case f: \
+ for (i=x-1; i >= 1; --i, cur[img_n]=255,raw+=img_n,cur+=out_n,prior+=out_n) \
+ for (k=0; k < img_n; ++k)
+ switch(filter) {
+ CASE(F_none) cur[k] = raw[k]; break;
+ CASE(F_sub) cur[k] = raw[k] + cur[k-out_n]; break;
+ CASE(F_up) cur[k] = raw[k] + prior[k]; break;
+ CASE(F_avg) cur[k] = raw[k] + ((prior[k] + cur[k-out_n])>>1); break;
+ CASE(F_paeth) cur[k] = (uint8) (raw[k] + paeth(cur[k-out_n],prior[k],prior[k-out_n])); break;
+ CASE(F_avg_first) cur[k] = raw[k] + (cur[k-out_n] >> 1); break;
+ CASE(F_paeth_first) cur[k] = (uint8) (raw[k] + paeth(cur[k-out_n],0,0)); break;
+ }
+ #undef CASE
+ }
+ }
+ return 1;
+}
+
+static int create_png_image(png *a, uint8 *raw, uint32 raw_len, int out_n, int interlaced)
+{
+ uint8 *final;
+ int p;
+ int save;
+ if (!interlaced)
+ return create_png_image_raw(a, raw, raw_len, out_n, a->s.img_x, a->s.img_y);
+ save = stbi_png_partial;
+ stbi_png_partial = 0;
+
+ // de-interlacing
+ final = (uint8 *) malloc(a->s.img_x * a->s.img_y * out_n);
+ for (p=0; p < 7; ++p) {
+ int xorig[] = { 0,4,0,2,0,1,0 };
+ int yorig[] = { 0,0,4,0,2,0,1 };
+ int xspc[] = { 8,8,4,4,2,2,1 };
+ int yspc[] = { 8,8,8,4,4,2,2 };
+ int i,j,x,y;
+ // pass1_x[4] = 0, pass1_x[5] = 1, pass1_x[12] = 1
+ x = (a->s.img_x - xorig[p] + xspc[p]-1) / xspc[p];
+ y = (a->s.img_y - yorig[p] + yspc[p]-1) / yspc[p];
+ if (x && y) {
+ if (!create_png_image_raw(a, raw, raw_len, out_n, x, y)) {
+ free(final);
+ return 0;
+ }
+ for (j=0; j < y; ++j)
+ for (i=0; i < x; ++i)
+ memcpy(final + (j*yspc[p]+yorig[p])*a->s.img_x*out_n + (i*xspc[p]+xorig[p])*out_n,
+ a->out + (j*x+i)*out_n, out_n);
+ free(a->out);
+ raw += (x*out_n+1)*y;
+ raw_len -= (x*out_n+1)*y;
+ }
+ }
+ a->out = final;
+
+ stbi_png_partial = save;
+ return 1;
+}
+
+static int compute_transparency(png *z, uint8 tc[3], int out_n)
+{
+ stbi *s = &z->s;
+ uint32 i, pixel_count = s->img_x * s->img_y;
+ uint8 *p = z->out;
+
+ // compute color-based transparency, assuming we've
+ // already got 255 as the alpha value in the output
+ assert(out_n == 2 || out_n == 4);
+
+ if (out_n == 2) {
+ for (i=0; i < pixel_count; ++i) {
+ p[1] = (p[0] == tc[0] ? 0 : 255);
+ p += 2;
+ }
+ } else {
+ for (i=0; i < pixel_count; ++i) {
+ if (p[0] == tc[0] && p[1] == tc[1] && p[2] == tc[2])
+ p[3] = 0;
+ p += 4;
+ }
+ }
+ return 1;
+}
+
+static int expand_palette(png *a, uint8 *palette, int /*len*/, int pal_img_n)
+{
+ uint32 i, pixel_count = a->s.img_x * a->s.img_y;
+ uint8 *p, *temp_out, *orig = a->out;
+
+ p = (uint8 *) malloc(pixel_count * pal_img_n);
+ if (p == NULL) return e("outofmem", "Out of memory");
+
+ // between here and free(out) below, exitting would leak
+ temp_out = p;
+
+ if (pal_img_n == 3) {
+ for (i=0; i < pixel_count; ++i) {
+ int n = orig[i]*4;
+ p[0] = palette[n ];
+ p[1] = palette[n+1];
+ p[2] = palette[n+2];
+ p += 3;
+ }
+ } else {
+ for (i=0; i < pixel_count; ++i) {
+ int n = orig[i]*4;
+ p[0] = palette[n ];
+ p[1] = palette[n+1];
+ p[2] = palette[n+2];
+ p[3] = palette[n+3];
+ p += 4;
+ }
+ }
+ free(a->out);
+ a->out = temp_out;
+ return 1;
+}
+
+static int parse_png_file(png *z, int scan, int req_comp)
+{
+ uint8 palette[1024], pal_img_n=0;
+ uint8 has_trans=0, tc[3];
+ uint32 ioff=0, idata_limit=0, i, pal_len=0;
+ int first=1,k,interlace=0;
+ stbi *s = &z->s;
+
+ if (!check_png_header(s)) return 0;
+
+ if (scan == SCAN_type) return 1;
+
+ for(;;first=0) {
+ chunk c = get_chunk_header(s);
+ if (first && c.type != PNG_TYPE('I','H','D','R'))
+ return e("first not IHDR","Corrupt PNG");
+ switch (c.type) {
+ case PNG_TYPE('I','H','D','R'): {
+ int depth,color,comp,filter;
+ if (!first) return e("multiple IHDR","Corrupt PNG");
+ if (c.length != 13) return e("bad IHDR len","Corrupt PNG");
+ s->img_x = get32(s); if (s->img_x > (1 << 24)) return e("too large","Very large image (corrupt?)");
+ s->img_y = get32(s); if (s->img_y > (1 << 24)) return e("too large","Very large image (corrupt?)");
+ depth = get8(s); if (depth != 8) return e("8bit only","PNG not supported: 8-bit only");
+ color = get8(s); if (color > 6) return e("bad ctype","Corrupt PNG");
+ if (color == 3) pal_img_n = 3; else if (color & 1) return e("bad ctype","Corrupt PNG");
+ comp = get8(s); if (comp) return e("bad comp method","Corrupt PNG");
+ filter= get8(s); if (filter) return e("bad filter method","Corrupt PNG");
+ interlace = get8(s); if (interlace>1) return e("bad interlace method","Corrupt PNG");
+ if (!s->img_x || !s->img_y) return e("0-pixel image","Corrupt PNG");
+ if (!pal_img_n) {
+ s->img_n = (color & 2 ? 3 : 1) + (color & 4 ? 1 : 0);
+ if ((1 << 30) / s->img_x / s->img_n < s->img_y) return e("too large", "Image too large to decode");
+ if (scan == SCAN_header) return 1;
+ } else {
+ // if paletted, then pal_n is our final components, and
+ // img_n is # components to decompress/filter.
+ s->img_n = 1;
+ if ((1 << 30) / s->img_x / 4 < s->img_y) return e("too large","Corrupt PNG");
+ // if SCAN_header, have to scan to see if we have a tRNS
+ }
+ break;
+ }
+
+ case PNG_TYPE('P','L','T','E'): {
+ if (c.length > 256*3) return e("invalid PLTE","Corrupt PNG");
+ pal_len = c.length / 3;
+ if (pal_len * 3 != c.length) return e("invalid PLTE","Corrupt PNG");
+ for (i=0; i < pal_len; ++i) {
+ palette[i*4+0] = get8u(s);
+ palette[i*4+1] = get8u(s);
+ palette[i*4+2] = get8u(s);
+ palette[i*4+3] = 255;
+ }
+ break;
+ }
+
+ case PNG_TYPE('t','R','N','S'): {
+ if (z->idata) return e("tRNS after IDAT","Corrupt PNG");
+ if (pal_img_n) {
+ if (scan == SCAN_header) { s->img_n = 4; return 1; }
+ if (pal_len == 0) return e("tRNS before PLTE","Corrupt PNG");
+ if (c.length > pal_len) return e("bad tRNS len","Corrupt PNG");
+ pal_img_n = 4;
+ for (i=0; i < c.length; ++i)
+ palette[i*4+3] = get8u(s);
+ } else {
+ if (!(s->img_n & 1)) return e("tRNS with alpha","Corrupt PNG");
+ if (c.length != (uint32) s->img_n*2) return e("bad tRNS len","Corrupt PNG");
+ has_trans = 1;
+ for (k=0; k < s->img_n; ++k)
+ tc[k] = (uint8) get16(s); // non 8-bit images will be larger
+ }
+ break;
+ }
+
+ case PNG_TYPE('I','D','A','T'): {
+ if (pal_img_n && !pal_len) return e("no PLTE","Corrupt PNG");
+ if (scan == SCAN_header) { s->img_n = pal_img_n; return 1; }
+ if (ioff + c.length > idata_limit) {
+ uint8 *p;
+ if (idata_limit == 0) idata_limit = c.length > 4096 ? c.length : 4096;
+ while (ioff + c.length > idata_limit)
+ idata_limit *= 2;
+ p = (uint8 *) realloc(z->idata, idata_limit); if (p == NULL) return e("outofmem", "Out of memory");
+ z->idata = p;
+ }
+ #ifndef STBI_NO_STDIO
+ if (s->img_file)
+ {
+ if (fread(z->idata+ioff,1,c.length,s->img_file) != c.length) return e("outofdata","Corrupt PNG");
+ }
+ else
+ #endif
+ {
+ memcpy(z->idata+ioff, s->img_buffer, c.length);
+ s->img_buffer += c.length;
+ }
+ ioff += c.length;
+ break;
+ }
+
+ case PNG_TYPE('I','E','N','D'): {
+ uint32 raw_len;
+ if (scan != SCAN_load) return 1;
+ if (z->idata == NULL) return e("no IDAT","Corrupt PNG");
+ z->expanded = (uint8 *) stbi_zlib_decode_malloc((char *) z->idata, ioff, (int *) &raw_len);
+ if (z->expanded == NULL) return 0; // zlib should set error
+ free(z->idata); z->idata = NULL;
+ if ((req_comp == s->img_n+1 && req_comp != 3 && !pal_img_n) || has_trans)
+ s->img_out_n = s->img_n+1;
+ else
+ s->img_out_n = s->img_n;
+ if (!create_png_image(z, z->expanded, raw_len, s->img_out_n, interlace)) return 0;
+ if (has_trans)
+ if (!compute_transparency(z, tc, s->img_out_n)) return 0;
+ if (pal_img_n) {
+ // pal_img_n == 3 or 4
+ s->img_n = pal_img_n; // record the actual colors we had
+ s->img_out_n = pal_img_n;
+ if (req_comp >= 3) s->img_out_n = req_comp;
+ if (!expand_palette(z, palette, pal_len, s->img_out_n))
+ return 0;
+ }
+ free(z->expanded); z->expanded = NULL;
+ return 1;
+ }
+
+ default:
+ // if critical, fail
+ if ((c.type & (1 << 29)) == 0) {
+ #ifndef STBI_NO_FAILURE_STRINGS
+ // not threadsafe
+ static char invalid_chunk[] = "XXXX chunk not known";
+ invalid_chunk[0] = (uint8) (c.type >> 24);
+ invalid_chunk[1] = (uint8) (c.type >> 16);
+ invalid_chunk[2] = (uint8) (c.type >> 8);
+ invalid_chunk[3] = (uint8) (c.type >> 0);
+ #endif
+ return e(invalid_chunk, "PNG not supported: unknown chunk type");
+ }
+ skip(s, c.length);
+ break;
+ }
+ // end of chunk, read and skip CRC
+ get32(s);
+ }
+}
+
+static unsigned char *do_png(png *p, int *x, int *y, int *n, int req_comp)
+{
+ unsigned char *result=NULL;
+ p->expanded = NULL;
+ p->idata = NULL;
+ p->out = NULL;
+ if (req_comp < 0 || req_comp > 4) return epuc("bad req_comp", "Internal error");
+ if (parse_png_file(p, SCAN_load, req_comp)) {
+ result = p->out;
+ p->out = NULL;
+ if (req_comp && req_comp != p->s.img_out_n) {
+ result = convert_format(result, p->s.img_out_n, req_comp, p->s.img_x, p->s.img_y);
+ p->s.img_out_n = req_comp;
+ if (result == NULL) return result;
+ }
+ *x = p->s.img_x;
+ *y = p->s.img_y;
+ if (n) *n = p->s.img_n;
+ }
+ free(p->out); p->out = NULL;
+ free(p->expanded); p->expanded = NULL;
+ free(p->idata); p->idata = NULL;
+
+ return result;
+}
+
+#ifndef STBI_NO_STDIO
+unsigned char *stbi_png_load_from_file(FILE *f, int *x, int *y, int *comp, int req_comp)
+{
+ png p;
+ start_file(&p.s, f);
+ return do_png(&p, x,y,comp,req_comp);
+}
+
+unsigned char *stbi_png_load(char const *filename, int *x, int *y, int *comp, int req_comp)
+{
+ unsigned char *data;
+ FILE *f = fopen(filename, "rb");
+ if (!f) return NULL;
+ data = stbi_png_load_from_file(f,x,y,comp,req_comp);
+ fclose(f);
+ return data;
+}
+#endif
+
+unsigned char *stbi_png_load_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp)
+{
+ png p;
+ start_mem(&p.s, buffer,len);
+ return do_png(&p, x,y,comp,req_comp);
+}
+
+#ifndef STBI_NO_STDIO
+int stbi_png_test_file(FILE *f)
+{
+ png p;
+ int n,r;
+ n = ftell(f);
+ start_file(&p.s, f);
+ r = parse_png_file(&p, SCAN_type,STBI_default);
+ fseek(f,n,SEEK_SET);
+ return r;
+}
+#endif
+
+int stbi_png_test_memory(stbi_uc const *buffer, int len)
+{
+ png p;
+ start_mem(&p.s, buffer, len);
+ return parse_png_file(&p, SCAN_type,STBI_default);
+}
+
+// TODO: load header from png
+#ifndef STBI_NO_STDIO
+int stbi_png_info (char const *filename, int *x, int *y, int *comp)
+{
+ png p;
+ FILE *f = fopen(filename, "rb");
+ if (!f) return 0;
+ start_file(&p.s, f);
+ if (parse_png_file(&p, SCAN_header, 0)) {
+ if(x) *x = p.s.img_x;
+ if(y) *y = p.s.img_y;
+ if (comp) *comp = p.s.img_n;
+ fclose(f);
+ return 1;
+ }
+ fclose(f);
+ return 0;
+}
+
+extern int stbi_png_info_from_file (FILE *f, int *x, int *y, int *comp);
+#endif
+extern int stbi_png_info_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *comp);
+
+// Microsoft/Windows BMP image
+
+static int bmp_test(stbi *s)
+{
+ int sz;
+ if (get8(s) != 'B') return 0;
+ if (get8(s) != 'M') return 0;
+ get32le(s); // discard filesize
+ get16le(s); // discard reserved
+ get16le(s); // discard reserved
+ get32le(s); // discard data offset
+ sz = get32le(s);
+ if (sz == 12 || sz == 40 || sz == 56 || sz == 108) return 1;
+ return 0;
+}
+
+#ifndef STBI_NO_STDIO
+int stbi_bmp_test_file (FILE *f)
+{
+ stbi s;
+ int r,n = ftell(f);
+ start_file(&s,f);
+ r = bmp_test(&s);
+ fseek(f,n,SEEK_SET);
+ return r;
+}
+#endif
+
+int stbi_bmp_test_memory (stbi_uc const *buffer, int len)
+{
+ stbi s;
+ start_mem(&s, buffer, len);
+ return bmp_test(&s);
+}
+
+// returns 0..31 for the highest set bit
+static int high_bit(unsigned int z)
+{
+ int n=0;
+ if (z == 0) return -1;
+ if (z >= 0x10000) n += 16, z >>= 16;
+ if (z >= 0x00100) n += 8, z >>= 8;
+ if (z >= 0x00010) n += 4, z >>= 4;
+ if (z >= 0x00004) n += 2, z >>= 2;
+ if (z >= 0x00002) n += 1, z >>= 1;
+ return n;
+}
+
+static int bitcount(unsigned int a)
+{
+ a = (a & 0x55555555) + ((a >> 1) & 0x55555555); // max 2
+ a = (a & 0x33333333) + ((a >> 2) & 0x33333333); // max 4
+ a = (a + (a >> 4)) & 0x0f0f0f0f; // max 8 per 4, now 8 bits
+ a = (a + (a >> 8)); // max 16 per 8 bits
+ a = (a + (a >> 16)); // max 32 per 8 bits
+ return a & 0xff;
+}
+
+static int shiftsigned(int v, int shift, int bits)
+{
+ int result;
+ int z=0;
+
+ if (shift < 0) v <<= -shift;
+ else v >>= shift;
+ result = v;
+
+ z = bits;
+ while (z < 8) {
+ result += v >> z;
+ z += bits;
+ }
+ return result;
+}
+
+static stbi_uc *bmp_load(stbi *s, int *x, int *y, int *comp, int req_comp)
+{
+ uint8 *out;
+ unsigned int mr=0,mg=0,mb=0,ma=0, fake_a=0;
+ stbi_uc pal[256][4];
+ int psize=0,i,j,compress=0,width;
+ int bpp, flip_vertically, pad, target, offset, hsz;
+ if (get8(s) != 'B' || get8(s) != 'M') return epuc("not BMP", "Corrupt BMP");
+ get32le(s); // discard filesize
+ get16le(s); // discard reserved
+ get16le(s); // discard reserved
+ offset = get32le(s);
+ hsz = get32le(s);
+ if (hsz != 12 && hsz != 40 && hsz != 56 && hsz != 108) return epuc("unknown BMP", "BMP type not supported: unknown");
+ failure_reason = "bad BMP";
+ if (hsz == 12) {
+ s->img_x = get16le(s);
+ s->img_y = get16le(s);
+ } else {
+ s->img_x = get32le(s);
+ s->img_y = get32le(s);
+ }
+ if (get16le(s) != 1) return 0;
+ bpp = get16le(s);
+ if (bpp == 1) return epuc("monochrome", "BMP type not supported: 1-bit");
+ flip_vertically = ((int) s->img_y) > 0;
+ s->img_y = abs((int) s->img_y);
+ if (hsz == 12) {
+ if (bpp < 24)
+ psize = (offset - 14 - 24) / 3;
+ } else {
+ compress = get32le(s);
+ if (compress == 1 || compress == 2) return epuc("BMP RLE", "BMP type not supported: RLE");
+ get32le(s); // discard sizeof
+ get32le(s); // discard hres
+ get32le(s); // discard vres
+ get32le(s); // discard colorsused
+ get32le(s); // discard max important
+ if (hsz == 40 || hsz == 56) {
+ if (hsz == 56) {
+ get32le(s);
+ get32le(s);
+ get32le(s);
+ get32le(s);
+ }
+ if (bpp == 16 || bpp == 32) {
+ mr = mg = mb = 0;
+ if (compress == 0) {
+ if (bpp == 32) {
+ mr = 0xff << 16;
+ mg = 0xff << 8;
+ mb = 0xff << 0;
+ ma = (unsigned int)(0xff << 24);
+ fake_a = 1; // @TODO: check for cases like alpha value is all 0 and switch it to 255
+ } else {
+ mr = 31 << 10;
+ mg = 31 << 5;
+ mb = 31 << 0;
+ }
+ } else if (compress == 3) {
+ mr = get32le(s);
+ mg = get32le(s);
+ mb = get32le(s);
+ // not documented, but generated by photoshop and handled by mspaint
+ if (mr == mg && mg == mb) {
+ // ?!?!?
+ return NULL;
+ }
+ } else
+ return NULL;
+ }
+ } else {
+ assert(hsz == 108);
+ mr = get32le(s);
+ mg = get32le(s);
+ mb = get32le(s);
+ ma = get32le(s);
+ get32le(s); // discard color space
+ for (i=0; i < 12; ++i)
+ get32le(s); // discard color space parameters
+ }
+ if (bpp < 16)
+ psize = (offset - 14 - hsz) >> 2;
+ }
+ s->img_n = ma ? 4 : 3;
+ if (req_comp && req_comp >= 3) // we can directly decode 3 or 4
+ target = req_comp;
+ else
+ target = s->img_n; // if they want monochrome, we'll post-convert
+ out = (stbi_uc *) malloc(target * s->img_x * s->img_y);
+ if (!out) return epuc("outofmem", "Out of memory");
+ if (bpp < 16) {
+ int z=0;
+ if (psize == 0 || psize > 256) { free(out); return epuc("invalid", "Corrupt BMP"); }
+ for (i=0; i < psize; ++i) {
+ pal[i][2] = (stbi_uc)get8(s);
+ pal[i][1] = (stbi_uc)get8(s);
+ pal[i][0] = (stbi_uc)get8(s);
+ if (hsz != 12) get8(s);
+ pal[i][3] = 255;
+ }
+ skip(s, offset - 14 - hsz - psize * (hsz == 12 ? 3 : 4));
+ if (bpp == 4) width = (s->img_x + 1) >> 1;
+ else if (bpp == 8) width = s->img_x;
+ else { free(out); return epuc("bad bpp", "Corrupt BMP"); }
+ pad = (-width)&3;
+ for (j=0; j < (int) s->img_y; ++j) {
+ for (i=0; i < (int) s->img_x; i += 2) {
+ int v=get8(s),v2=0;
+ if (bpp == 4) {
+ v2 = v & 15;
+ v >>= 4;
+ }
+ out[z++] = pal[v][0];
+ out[z++] = pal[v][1];
+ out[z++] = pal[v][2];
+ if (target == 4) out[z++] = 255;
+ if (i+1 == (int) s->img_x) break;
+ v = (bpp == 8) ? get8(s) : v2;
+ out[z++] = pal[v][0];
+ out[z++] = pal[v][1];
+ out[z++] = pal[v][2];
+ if (target == 4) out[z++] = 255;
+ }
+ skip(s, pad);
+ }
+ } else {
+ int rshift=0,gshift=0,bshift=0,ashift=0,rcount=0,gcount=0,bcount=0,acount=0;
+ int z = 0;
+ int easy=0;
+ skip(s, offset - 14 - hsz);
+ if (bpp == 24) width = 3 * s->img_x;
+ else if (bpp == 16) width = 2*s->img_x;
+ else /* bpp = 32 and pad = 0 */ width=0;
+ pad = (-width) & 3;
+ if (bpp == 24) {
+ easy = 1;
+ } else if (bpp == 32) {
+ if (mb == 0xff && mg == 0xff00 && mr == 0xff000000 && ma == 0xff000000)
+ easy = 2;
+ }
+ if (!easy) {
+ if (!mr || !mg || !mb) return epuc("bad masks", "Corrupt BMP");
+ // right shift amt to put high bit in position #7
+ rshift = high_bit(mr)-7; rcount = bitcount(mr);
+ gshift = high_bit(mg)-7; gcount = bitcount(mr);
+ bshift = high_bit(mb)-7; bcount = bitcount(mr);
+ ashift = high_bit(ma)-7; acount = bitcount(mr);
+ }
+ for (j=0; j < (int) s->img_y; ++j) {
+ if (easy) {
+ for (i=0; i < (int) s->img_x; ++i) {
+ int a;
+ out[z+2] = (uint8)get8(s);
+ out[z+1] = (uint8)get8(s);
+ out[z+0] = (uint8)get8(s);
+ z += 3;
+ a = (easy == 2 ? get8(s) : 255);
+ if (target == 4) out[z++] = (uint8)a;
+ }
+ } else {
+ for (i=0; i < (int) s->img_x; ++i) {
+ uint32 v = (bpp == 16 ? get16le(s) : get32le(s));
+ int a;
+ out[z++] = (uint8)shiftsigned(v & mr, rshift, rcount);
+ out[z++] = (uint8)shiftsigned(v & mg, gshift, gcount);
+ out[z++] = (uint8)shiftsigned(v & mb, bshift, bcount);
+ a = (ma ? shiftsigned(v & ma, ashift, acount) : 255);
+ if (target == 4) out[z++] = (uint8)a;
+ }
+ }
+ skip(s, pad);
+ }
+ }
+ if (flip_vertically) {
+ stbi_uc t;
+ for (j=0; j < (int) s->img_y>>1; ++j) {
+ stbi_uc *p1 = out + j *s->img_x*target;
+ stbi_uc *p2 = out + (s->img_y-1-j)*s->img_x*target;
+ for (i=0; i < (int) s->img_x*target; ++i) {
+ t = p1[i], p1[i] = p2[i], p2[i] = t;
+ }
+ }
+ }
+
+ if (req_comp && req_comp != target) {
+ out = convert_format(out, target, req_comp, s->img_x, s->img_y);
+ if (out == NULL) return out; // convert_format frees input on failure
+ }
+
+ *x = s->img_x;
+ *y = s->img_y;
+ if (comp) *comp = target;
+ return out;
+}
+
+#ifndef STBI_NO_STDIO
+stbi_uc *stbi_bmp_load (char const *filename, int *x, int *y, int *comp, int req_comp)
+{
+ stbi_uc *data;
+ FILE *f = fopen(filename, "rb");
+ if (!f) return NULL;
+ data = stbi_bmp_load_from_file(f, x,y,comp,req_comp);
+ fclose(f);
+ return data;
+}
+
+stbi_uc *stbi_bmp_load_from_file (FILE *f, int *x, int *y, int *comp, int req_comp)
+{
+ stbi s;
+ start_file(&s, f);
+ return bmp_load(&s, x,y,comp,req_comp);
+}
+#endif
+
+stbi_uc *stbi_bmp_load_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp)
+{
+ stbi s;
+ start_mem(&s, buffer, len);
+ return bmp_load(&s, x,y,comp,req_comp);
+}
+
+// Targa Truevision - TGA
+// by Jonathan Dummer
+
+static int tga_test(stbi *s)
+{
+ int sz;
+ get8u(s); // discard Offset
+ sz = get8u(s); // color type
+ if( sz > 1 ) return 0; // only RGB or indexed allowed
+ sz = get8u(s); // image type
+ if( (sz != 1) && (sz != 2) && (sz != 3) && (sz != 9) && (sz != 10) && (sz != 11) ) return 0; // only RGB or grey allowed, +/- RLE
+ get16(s); // discard palette start
+ get16(s); // discard palette length
+ get8(s); // discard bits per palette color entry
+ get16(s); // discard x origin
+ get16(s); // discard y origin
+ if( get16(s) < 1 ) return 0; // test width
+ if( get16(s) < 1 ) return 0; // test height
+ sz = get8(s); // bits per pixel
+ if( (sz != 8) && (sz != 16) && (sz != 24) && (sz != 32) ) return 0; // only RGB or RGBA or grey allowed
+ return 1; // seems to have passed everything
+}
+
+#ifndef STBI_NO_STDIO
+int stbi_tga_test_file (FILE *f)
+{
+ stbi s;
+ int r,n = ftell(f);
+ start_file(&s, f);
+ r = tga_test(&s);
+ fseek(f,n,SEEK_SET);
+ return r;
+}
+#endif
+
+int stbi_tga_test_memory (stbi_uc const *buffer, int len)
+{
+ stbi s;
+ start_mem(&s, buffer, len);
+ return tga_test(&s);
+}
+
+static stbi_uc *tga_load(stbi *s, int *x, int *y, int *comp, int req_comp)
+{
+ // read in the TGA header stuff
+ int tga_offset = get8u(s);
+ int tga_indexed = get8u(s);
+ int tga_image_type = get8u(s);
+ int tga_is_RLE = 0;
+ int tga_palette_start = get16le(s);
+ int tga_palette_len = get16le(s);
+ int tga_palette_bits = get8u(s);
+ int tga_x_origin = get16le(s);
+ int tga_y_origin = get16le(s);
+ int tga_width = get16le(s);
+ int tga_height = get16le(s);
+ int tga_bits_per_pixel = get8u(s);
+ int tga_inverted = get8u(s);
+ // image data
+ unsigned char *tga_data;
+ unsigned char *tga_palette = NULL;
+ int i, j;
+ unsigned char raw_data[4] = {0,0,0,0};
+ unsigned char trans_data[4] = {0,0,0,0};
+ int RLE_count = 0;
+ int RLE_repeating = 0;
+ int read_next_pixel = 1;
+ // do a tiny bit of precessing
+ if( tga_image_type >= 8 )
+ {
+ tga_image_type -= 8;
+ tga_is_RLE = 1;
+ }
+ /* int tga_alpha_bits = tga_inverted & 15; */
+ tga_inverted = 1 - ((tga_inverted >> 5) & 1);
+
+ // error check
+ if( //(tga_indexed) ||
+ (tga_width < 1) || (tga_height < 1) ||
+ (tga_image_type < 1) || (tga_image_type > 3) ||
+ ((tga_bits_per_pixel != 8) && (tga_bits_per_pixel != 16) &&
+ (tga_bits_per_pixel != 24) && (tga_bits_per_pixel != 32))
+ )
+ {
+ return NULL;
+ }
+
+ // If I'm paletted, then I'll use the number of bits from the palette
+ if( tga_indexed )
+ {
+ tga_bits_per_pixel = tga_palette_bits;
+ }
+
+ // tga info
+ *x = tga_width;
+ *y = tga_height;
+ if( (req_comp < 1) || (req_comp > 4) )
+ {
+ // just use whatever the file was
+ req_comp = tga_bits_per_pixel / 8;
+ *comp = req_comp;
+ } else
+ {
+ // force a new number of components
+ *comp = tga_bits_per_pixel/8;
+ }
+ tga_data = (unsigned char*)malloc( tga_width * tga_height * req_comp );
+
+ // skip to the data's starting position (offset usually = 0)
+ skip(s, tga_offset );
+ // do I need to load a palette?
+ if( tga_indexed )
+ {
+ // any data to skip? (offset usually = 0)
+ skip(s, tga_palette_start );
+ // load the palette
+ tga_palette = (unsigned char*)malloc( tga_palette_len * tga_palette_bits / 8 );
+ getn(s, tga_palette, tga_palette_len * tga_palette_bits / 8 );
+ }
+ // load the data
+ for( i = 0; i < tga_width * tga_height; ++i )
+ {
+ // if I'm in RLE mode, do I need to get a RLE chunk?
+ if( tga_is_RLE )
+ {
+ if( RLE_count == 0 )
+ {
+ // yep, get the next byte as a RLE command
+ int RLE_cmd = get8u(s);
+ RLE_count = 1 + (RLE_cmd & 127);
+ RLE_repeating = RLE_cmd >> 7;
+ read_next_pixel = 1;
+ } else if( !RLE_repeating )
+ {
+ read_next_pixel = 1;
+ }
+ } else
+ {
+ read_next_pixel = 1;
+ }
+ // OK, if I need to read a pixel, do it now
+ if( read_next_pixel )
+ {
+ // load however much data we did have
+ if( tga_indexed )
+ {
+ // read in 1 byte, then perform the lookup
+ int pal_idx = get8u(s);
+ if( pal_idx >= tga_palette_len )
+ {
+ // invalid index
+ pal_idx = 0;
+ }
+ pal_idx *= tga_bits_per_pixel / 8;
+ for( j = 0; j*8 < tga_bits_per_pixel; ++j )
+ {
+ raw_data[j] = tga_palette[pal_idx+j];
+ }
+ } else
+ {
+ // read in the data raw
+ for( j = 0; j*8 < tga_bits_per_pixel; ++j )
+ {
+ raw_data[j] = get8u(s);
+ }
+ }
+ // convert raw to the intermediate format
+ switch( tga_bits_per_pixel )
+ {
+ case 8:
+ // Luminous => RGBA
+ trans_data[0] = raw_data[0];
+ trans_data[1] = raw_data[0];
+ trans_data[2] = raw_data[0];
+ trans_data[3] = 255;
+ break;
+ case 16:
+ // Luminous,Alpha => RGBA
+ trans_data[0] = raw_data[0];
+ trans_data[1] = raw_data[0];
+ trans_data[2] = raw_data[0];
+ trans_data[3] = raw_data[1];
+ break;
+ case 24:
+ // BGR => RGBA
+ trans_data[0] = raw_data[2];
+ trans_data[1] = raw_data[1];
+ trans_data[2] = raw_data[0];
+ trans_data[3] = 255;
+ break;
+ case 32:
+ // BGRA => RGBA
+ trans_data[0] = raw_data[2];
+ trans_data[1] = raw_data[1];
+ trans_data[2] = raw_data[0];
+ trans_data[3] = raw_data[3];
+ break;
+ }
+ // clear the reading flag for the next pixel
+ read_next_pixel = 0;
+ } // end of reading a pixel
+ // convert to final format
+ switch( req_comp )
+ {
+ case 1:
+ // RGBA => Luminance
+ tga_data[i*req_comp+0] = compute_y(trans_data[0],trans_data[1],trans_data[2]);
+ break;
+ case 2:
+ // RGBA => Luminance,Alpha
+ tga_data[i*req_comp+0] = compute_y(trans_data[0],trans_data[1],trans_data[2]);
+ tga_data[i*req_comp+1] = trans_data[3];
+ break;
+ case 3:
+ // RGBA => RGB
+ tga_data[i*req_comp+0] = trans_data[0];
+ tga_data[i*req_comp+1] = trans_data[1];
+ tga_data[i*req_comp+2] = trans_data[2];
+ break;
+ case 4:
+ // RGBA => RGBA
+ tga_data[i*req_comp+0] = trans_data[0];
+ tga_data[i*req_comp+1] = trans_data[1];
+ tga_data[i*req_comp+2] = trans_data[2];
+ tga_data[i*req_comp+3] = trans_data[3];
+ break;
+ }
+ // in case we're in RLE mode, keep counting down
+ --RLE_count;
+ }
+ // do I need to invert the image?
+ if( tga_inverted )
+ {
+ for( j = 0; j*2 < tga_height; ++j )
+ {
+ int index1 = j * tga_width * req_comp;
+ int index2 = (tga_height - 1 - j) * tga_width * req_comp;
+ for( i = tga_width * req_comp; i > 0; --i )
+ {
+ unsigned char temp = tga_data[index1];
+ tga_data[index1] = tga_data[index2];
+ tga_data[index2] = temp;
+ ++index1;
+ ++index2;
+ }
+ }
+ }
+ // clear my palette, if I had one
+ if( tga_palette != NULL )
+ {
+ free( tga_palette );
+ }
+ // the things I do to get rid of an error message, and yet keep
+ // Microsoft's C compilers happy... [8^(
+ tga_palette_start = tga_palette_len = tga_palette_bits =
+ tga_x_origin = tga_y_origin = 0;
+ // OK, done
+ return tga_data;
+}
+
+#ifndef STBI_NO_STDIO
+stbi_uc *stbi_tga_load (char const *filename, int *x, int *y, int *comp, int req_comp)
+{
+ stbi_uc *data;
+ FILE *f = fopen(filename, "rb");
+ if (!f) return NULL;
+ data = stbi_tga_load_from_file(f, x,y,comp,req_comp);
+ fclose(f);
+ return data;
+}
+
+stbi_uc *stbi_tga_load_from_file (FILE *f, int *x, int *y, int *comp, int req_comp)
+{
+ stbi s;
+ start_file(&s, f);
+ return tga_load(&s, x,y,comp,req_comp);
+}
+#endif
+
+stbi_uc *stbi_tga_load_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp)
+{
+ stbi s;
+ start_mem(&s, buffer, len);
+ return tga_load(&s, x,y,comp,req_comp);
+}
+
+
+// *************************************************************************************************
+// Photoshop PSD loader -- PD by Thatcher Ulrich, integration by Nicholas Schulz, tweaked by STB
+
+static int psd_test(stbi *s)
+{
+ if (get32(s) != 0x38425053) return 0; // "8BPS"
+ else return 1;
+}
+
+#ifndef STBI_NO_STDIO
+int stbi_psd_test_file(FILE *f)
+{
+ stbi s;
+ int r,n = ftell(f);
+ start_file(&s, f);
+ r = psd_test(&s);
+ fseek(f,n,SEEK_SET);
+ return r;
+}
+#endif
+
+int stbi_psd_test_memory(stbi_uc const *buffer, int len)
+{
+ stbi s;
+ start_mem(&s, buffer, len);
+ return psd_test(&s);
+}
+
+static stbi_uc *psd_load(stbi *s, int *x, int *y, int *comp, int req_comp)
+{
+ int pixelCount;
+ int channelCount, compression;
+ int channel, i, count, len;
+ int w,h;
+ uint8 *out;
+
+ // Check identifier
+ if (get32(s) != 0x38425053) // "8BPS"
+ return epuc("not PSD", "Corrupt PSD image");
+
+ // Check file type version.
+ if (get16(s) != 1)
+ return epuc("wrong version", "Unsupported version of PSD image");
+
+ // Skip 6 reserved bytes.
+ skip(s, 6 );
+
+ // Read the number of channels (R, G, B, A, etc).
+ channelCount = get16(s);
+ if (channelCount < 0 || channelCount > 16)
+ return epuc("wrong channel count", "Unsupported number of channels in PSD image");
+
+ // Read the rows and columns of the image.
+ h = get32(s);
+ w = get32(s);
+
+ // Make sure the depth is 8 bits.
+ if (get16(s) != 8)
+ return epuc("unsupported bit depth", "PSD bit depth is not 8 bit");
+
+ // Make sure the color mode is RGB.
+ // Valid options are:
+ // 0: Bitmap
+ // 1: Grayscale
+ // 2: Indexed color
+ // 3: RGB color
+ // 4: CMYK color
+ // 7: Multichannel
+ // 8: Duotone
+ // 9: Lab color
+ if (get16(s) != 3)
+ return epuc("wrong color format", "PSD is not in RGB color format");
+
+ // Skip the Mode Data. (It's the palette for indexed color; other info for other modes.)
+ skip(s,get32(s) );
+
+ // Skip the image resources. (resolution, pen tool paths, etc)
+ skip(s, get32(s) );
+
+ // Skip the reserved data.
+ skip(s, get32(s) );
+
+ // Find out if the data is compressed.
+ // Known values:
+ // 0: no compression
+ // 1: RLE compressed
+ compression = get16(s);
+ if (compression > 1)
+ return epuc("bad compression", "PSD has an unknown compression format");
+
+ // Create the destination image.
+ out = (stbi_uc *) malloc(4 * w*h);
+ if (!out) return epuc("outofmem", "Out of memory");
+ pixelCount = w*h;
+
+ // Initialize the data to zero.
+ //memset( out, 0, pixelCount * 4 );
+
+ // Finally, the image data.
+ if (compression) {
+ // RLE as used by .PSD and .TIFF
+ // Loop until you get the number of unpacked bytes you are expecting:
+ // Read the next source byte into n.
+ // If n is between 0 and 127 inclusive, copy the next n+1 bytes literally.
+ // Else if n is between -127 and -1 inclusive, copy the next byte -n+1 times.
+ // Else if n is 128, noop.
+ // Endloop
+
+ // The RLE-compressed data is preceeded by a 2-byte data count for each row in the data,
+ // which we're going to just skip.
+ skip(s, h * channelCount * 2 );
+
+ // Read the RLE data by channel.
+ for (channel = 0; channel < 4; channel++) {
+ uint8 *p;
+
+ p = out+channel;
+ if (channel >= channelCount) {
+ // Fill this channel with default data.
+ for (i = 0; i < pixelCount; i++) *p = (channel == 3 ? 255 : 0), p += 4;
+ } else {
+ // Read the RLE data.
+ count = 0;
+ while (count < pixelCount) {
+ len = get8(s);
+ if (len == 128) {
+ // No-op.
+ } else if (len < 128) {
+ // Copy next len+1 bytes literally.
+ len++;
+ count += len;
+ while (len) {
+ *p = (uint8)get8(s);
+ p += 4;
+ len--;
+ }
+ } else if (len > 128) {
+ uint32 val;
+ // Next -len+1 bytes in the dest are replicated from next source byte.
+ // (Interpret len as a negative 8-bit int.)
+ len ^= 0x0FF;
+ len += 2;
+ val = get8(s);
+ count += len;
+ while (len) {
+ *p = (uint8)val;
+ p += 4;
+ len--;
+ }
+ }
+ }
+ }
+ }
+
+ } else {
+ // We're at the raw image data. It's each channel in order (Red, Green, Blue, Alpha, ...)
+ // where each channel consists of an 8-bit value for each pixel in the image.
+
+ // Read the data by channel.
+ for (channel = 0; channel < 4; channel++) {
+ uint8 *p;
+
+ p = out + channel;
+ if (channel > channelCount) {
+ // Fill this channel with default data.
+ for (i = 0; i < pixelCount; i++) *p = channel == 3 ? 255 : 0, p += 4;
+ } else {
+ // Read the data.
+ count = 0;
+ for (i = 0; i < pixelCount; i++)
+ *p = (uint8)get8(s), p += 4;
+ }
+ }
+ }
+
+ if (req_comp && req_comp != 4) {
+ out = convert_format(out, 4, req_comp, w, h);
+ if (out == NULL) return out; // convert_format frees input on failure
+ }
+
+ if (comp) *comp = channelCount;
+ *y = h;
+ *x = w;
+
+ return out;
+}
+
+#ifndef STBI_NO_STDIO
+stbi_uc *stbi_psd_load(char const *filename, int *x, int *y, int *comp, int req_comp)
+{
+ stbi_uc *data;
+ FILE *f = fopen(filename, "rb");
+ if (!f) return NULL;
+ data = stbi_psd_load_from_file(f, x,y,comp,req_comp);
+ fclose(f);
+ return data;
+}
+
+stbi_uc *stbi_psd_load_from_file(FILE *f, int *x, int *y, int *comp, int req_comp)
+{
+ stbi s;
+ start_file(&s, f);
+ return psd_load(&s, x,y,comp,req_comp);
+}
+#endif
+
+stbi_uc *stbi_psd_load_from_memory (stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp)
+{
+ stbi s;
+ start_mem(&s, buffer, len);
+ return psd_load(&s, x,y,comp,req_comp);
+}
+
+
+// *************************************************************************************************
+// Radiance RGBE HDR loader
+// originally by Nicolas Schulz
+#ifndef STBI_NO_HDR
+static int hdr_test(stbi *s)
+{
+ const char *signature = "#?RADIANCE\n";
+ int i;
+ for (i=0; signature[i]; ++i)
+ if (get8(s) != signature[i])
+ return 0;
+ return 1;
+}
+
+int stbi_hdr_test_memory(stbi_uc const *buffer, int len)
+{
+ stbi s;
+ start_mem(&s, buffer, len);
+ return hdr_test(&s);
+}
+
+#ifndef STBI_NO_STDIO
+int stbi_hdr_test_file(FILE *f)
+{
+ stbi s;
+ int r,n = ftell(f);
+ start_file(&s, f);
+ r = hdr_test(&s);
+ fseek(f,n,SEEK_SET);
+ return r;
+}
+#endif
+
+#define HDR_BUFLEN 1024
+static char *hdr_gettoken(stbi *z, char *buffer)
+{
+ int len=0;
+ char c = '\0';
+
+ c = (char)get8(z);
+
+ while (!at_eof(z) && c != '\n') {
+ buffer[len++] = c;
+ if (len == HDR_BUFLEN-1) {
+ // flush to end of line
+ while (!at_eof(z) && get8(z) != '\n')
+ ;
+ break;
+ }
+ c = (char)get8(z);
+ }
+
+ buffer[len] = 0;
+ return buffer;
+}
+
+static void hdr_convert(float *output, stbi_uc *input, int req_comp)
+{
+ if( input[3] != 0 ) {
+ float f1;
+ // Exponent
+ f1 = (float) ldexp(1.0f, input[3] - (int)(128 + 8));
+ if (req_comp <= 2)
+ output[0] = (input[0] + input[1] + input[2]) * f1 / 3;
+ else {
+ output[0] = input[0] * f1;
+ output[1] = input[1] * f1;
+ output[2] = input[2] * f1;
+ }
+ if (req_comp == 2) output[1] = 1;
+ if (req_comp == 4) output[3] = 1;
+ } else {
+ switch (req_comp) {
+ case 4: output[3] = 1; /* fallthrough */
+ case 3: output[0] = output[1] = output[2] = 0;
+ break;
+ case 2: output[1] = 1; /* fallthrough */
+ case 1: output[0] = 0;
+ break;
+ }
+ }
+}
+
+
+static float *hdr_load(stbi *s, int *x, int *y, int *comp, int req_comp)
+{
+ char buffer[HDR_BUFLEN];
+ char *token;
+ int valid = 0;
+ int width, height;
+ stbi_uc *scanline;
+ float *hdr_data;
+ int len;
+ unsigned char count, value;
+ int i, j, k, c1,c2, z;
+
+
+ // Check identifier
+ if (strcmp(hdr_gettoken(s,buffer), "#?RADIANCE") != 0)
+ return epf("not HDR", "Corrupt HDR image");
+
+ // Parse header
+ for(;;) {
+ token = hdr_gettoken(s,buffer);
+ if (token[0] == 0) break;
+ if (strcmp(token, "FORMAT=32-bit_rle_rgbe") == 0) valid = 1;
+ }
+
+ if (!valid) return epf("unsupported format", "Unsupported HDR format");
+
+ // Parse width and height
+ // can't use sscanf() if we're not using stdio!
+ token = hdr_gettoken(s,buffer);
+ if (strncmp(token, "-Y ", 3)) return epf("unsupported data layout", "Unsupported HDR format");
+ token += 3;
+ height = strtol(token, &token, 10);
+ while (*token == ' ') ++token;
+ if (strncmp(token, "+X ", 3)) return epf("unsupported data layout", "Unsupported HDR format");
+ token += 3;
+ width = strtol(token, NULL, 10);
+
+ *x = width;
+ *y = height;
+
+ *comp = 3;
+ if (req_comp == 0) req_comp = 3;
+
+ // Read data
+ hdr_data = (float *) malloc(height * width * req_comp * sizeof(float));
+
+ // Load image data
+ // image data is stored as some number of sca
+ if( width < 8 || width >= 32768) {
+ // Read flat data
+ for (j=0; j < height; ++j) {
+ for (i=0; i < width; ++i) {
+ stbi_uc rgbe[4];
+ main_decode_loop:
+ getn(s, rgbe, 4);
+ hdr_convert(hdr_data + j * width * req_comp + i * req_comp, rgbe, req_comp);
+ }
+ }
+ } else {
+ // Read RLE-encoded data
+ scanline = NULL;
+
+ for (j = 0; j < height; ++j) {
+ c1 = get8(s);
+ c2 = get8(s);
+ len = get8(s);
+ if (c1 != 2 || c2 != 2 || (len & 0x80)) {
+ // not run-length encoded, so we have to actually use THIS data as a decoded
+ // pixel (note this can't be a valid pixel--one of RGB must be >= 128)
+ stbi_uc rgbe[4] = { (stbi_uc)c1,(stbi_uc)c2,(stbi_uc)len, (stbi_uc)get8(s) };
+ hdr_convert(hdr_data, rgbe, req_comp);
+ i = 1;
+ j = 0;
+ free(scanline);
+ goto main_decode_loop; // yes, this is fucking insane; blame the fucking insane format
+ }
+ len <<= 8;
+ len |= get8(s);
+ if (len != width) { free(hdr_data); free(scanline); return epf("invalid decoded scanline length", "corrupt HDR"); }
+ if (scanline == NULL) scanline = (stbi_uc *) malloc(width * 4);
+
+ for (k = 0; k < 4; ++k) {
+ i = 0;
+ while (i < width) {
+ count = (unsigned char)get8(s);
+ if (count > 128) {
+ // Run
+ value = (unsigned char)get8(s);
+ count -= 128;
+ for (z = 0; z < count; ++z)
+ scanline[i++ * 4 + k] = value;
+ } else {
+ // Dump
+ for (z = 0; z < count; ++z)
+ scanline[i++ * 4 + k] = (stbi_uc)get8(s);
+ }
+ }
+ }
+ for (i=0; i < width; ++i)
+ hdr_convert(hdr_data+(j*width + i)*req_comp, scanline + i*4, req_comp);
+ }
+ free(scanline);
+ }
+
+ return hdr_data;
+}
+
+#ifndef STBI_NO_STDIO
+float *stbi_hdr_load_from_file(FILE *f, int *x, int *y, int *comp, int req_comp)
+{
+ stbi s;
+ start_file(&s,f);
+ return hdr_load(&s,x,y,comp,req_comp);
+}
+#endif
+
+float *stbi_hdr_load_from_memory(stbi_uc const *buffer, int len, int *x, int *y, int *comp, int req_comp)
+{
+ stbi s;
+ start_mem(&s,buffer, len);
+ return hdr_load(&s,x,y,comp,req_comp);
+}
+
+#endif // STBI_NO_HDR
+
+/////////////////////// write image ///////////////////////
+
+#ifndef STBI_NO_WRITE
+
+static void write8(FILE *f, int x) { uint8 z = (uint8) x; fwrite(&z,1,1,f); }
+
+static void writefv(FILE *f, const char *fmt, va_list v)
+{
+ while (*fmt) {
+ switch (*fmt++) {
+ case ' ': break;
+ case '1': { uint8 x = (uint8)va_arg(v, int); write8(f,x); break; }
+ case '2': { int16 x = (int16)va_arg(v, int); write8(f,x); write8(f,x>>8); break; }
+ case '4': { int32 x = va_arg(v, int); write8(f,x); write8(f,x>>8); write8(f,x>>16); write8(f,x>>24); break; }
+ default:
+ assert(0);
+ va_end(v);
+ return;
+ }
+ }
+}
+
+static void writef(FILE *f, const char *fmt, ...)
+{
+ va_list v;
+ va_start(v, fmt);
+ writefv(f,fmt,v);
+ va_end(v);
+}
+
+static void write_pixels(FILE *f, int rgb_dir, int vdir, int x, int y, int comp, void *data, int write_alpha, int scanline_pad)
+{
+ uint8 bg[3] = { 255, 0, 255}, px[3];
+ uint32 zero = 0;
+ int i,j,k, j_end;
+
+ if (vdir < 0)
+ j_end = -1, j = y-1;
+ else
+ j_end = y, j = 0;
+
+ for (; j != j_end; j += vdir) {
+ for (i=0; i < x; ++i) {
+ uint8 *d = (uint8 *) data + (j*x+i)*comp;
+ if (write_alpha < 0)
+ fwrite(&d[comp-1], 1, 1, f);
+ switch (comp) {
+ case 1:
+ case 2: writef(f, "111", d[0],d[0],d[0]);
+ break;
+ case 4:
+ if (!write_alpha) {
+ for (k=0; k < 3; ++k)
+ px[k] = bg[k] + ((d[k] - bg[k]) * d[3])/255;
+ writef(f, "111", px[1-rgb_dir],px[1],px[1+rgb_dir]);
+ break;
+ }
+ /* FALLTHROUGH */
+ case 3:
+ writef(f, "111", d[1-rgb_dir],d[1],d[1+rgb_dir]);
+ break;
+ }
+ if (write_alpha > 0)
+ fwrite(&d[comp-1], 1, 1, f);
+ }
+ fwrite(&zero,scanline_pad,1,f);
+ }
+}
+
+static int outfile(char const *filename, int rgb_dir, int vdir, int x, int y, int comp, void *data, int alpha, int pad, const char *fmt, ...)
+{
+ FILE *f = fopen(filename, "wb");
+ if (f) {
+ va_list v;
+ va_start(v, fmt);
+ writefv(f, fmt, v);
+ va_end(v);
+ write_pixels(f,rgb_dir,vdir,x,y,comp,data,alpha,pad);
+ fclose(f);
+ }
+ return f != NULL;
+}
+
+int stbi_write_bmp(char const *filename, int x, int y, int comp, void *data)
+{
+ int pad = (-x*3) & 3;
+ return outfile(filename,-1,-1,x,y,comp,data,0,pad,
+ "11 4 22 4" "4 44 22 444444",
+ 'B', 'M', 14+40+(x*3+pad)*y, 0,0, 14+40, // file header
+ 40, x,y, 1,24, 0,0,0,0,0,0); // bitmap header
+}
+
+int stbi_write_tga(char const *filename, int x, int y, int comp, void *data)
+{
+ int has_alpha = !(comp & 1);
+ return outfile(filename, -1,-1, x, y, comp, data, has_alpha, 0,
+ "111 221 2222 11", 0,0,2, 0,0,0, 0,0,x,y, 24+8*has_alpha, 8*has_alpha);
+}
+
+// any other image formats that do interleaved rgb data?
+// PNG: requires adler32,crc32 -- significant amount of code
+// PSD: no, channels output separately
+// TIFF: no, stripwise-interleaved... i think
+
+#endif // STBI_NO_WRITE
+
+#endif // STBI_HEADER_FILE_ONLY
+
diff --git a/dep/recastnavigation/RecastDemo/Contrib/stb_truetype.h b/dep/recastnavigation/RecastDemo/Contrib/stb_truetype.h
new file mode 100644
index 000000000..92dc8c244
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Contrib/stb_truetype.h
@@ -0,0 +1,1806 @@
+// stb_truetype.h - v0.3 - public domain - 2009 Sean Barrett / RAD Game Tools
+//
+// This library processes TrueType files:
+// parse files
+// extract glyph metrics
+// extract glyph shapes
+// render glyphs to one-channel bitmaps with antialiasing (box filter)
+//
+// Todo:
+// non-MS cmaps
+// crashproof on bad data
+// hinting
+// subpixel positioning when rendering bitmap
+// cleartype-style AA
+//
+// ADDITIONAL CONTRIBUTORS
+//
+// Mikko Mononen: compound shape support, more cmap formats
+//
+// VERSIONS
+//
+// 0.3 (2009-06-24) cmap fmt=12, compound shapes (MM)
+// userdata, malloc-from-userdata, non-zero fill (STB)
+// 0.2 (2009-03-11) Fix unsigned/signed char warnings
+// 0.1 (2009-03-09) First public release
+//
+// USAGE
+//
+// Include this file in whatever places neeed to refer to it. In ONE C/C++
+// file, write:
+// #define STB_TRUETYPE_IMPLEMENTATION
+// before the #include of this file. This expands out the actual
+// implementation into that C/C++ file.
+//
+// Look at the header-file sections below for the API, but here's a quick skim:
+//
+// Simple 3D API (don't ship this, but it's fine for tools and quick start,
+// and you can cut and paste from it to move to more advanced)
+// stbtt_BakeFontBitmap() -- bake a font to a bitmap for use as texture
+// stbtt_GetBakedQuad() -- compute quad to draw for a given char
+//
+// "Load" a font file from a memory buffer (you have to keep the buffer loaded)
+// stbtt_InitFont()
+// stbtt_GetFontOffsetForIndex() -- use for TTC font collections
+//
+// Render a unicode codepoint to a bitmap
+// stbtt_GetCodepointBitmap() -- allocates and returns a bitmap
+// stbtt_MakeCodepointBitmap() -- renders into bitmap you provide
+// stbtt_GetCodepointBitmapBox() -- how big the bitmap must be
+//
+// Character advance/positioning
+// stbtt_GetCodepointHMetrics()
+// stbtt_GetFontVMetrics()
+//
+// NOTES
+//
+// The system uses the raw data found in the .ttf file without changing it
+// and without building auxiliary data structures. This is a bit inefficient
+// on little-endian systems (the data is big-endian), but assuming you're
+// caching the bitmaps or glyph shapes this shouldn't be a big deal.
+//
+// It appears to be very hard to programmatically determine what font a
+// given file is in a general way. I provide an API for this, but I don't
+// recommend it.
+//
+//
+// SOURCE STATISTICS (based on v0.3, 1800 LOC)
+//
+// Documentation & header file 350 LOC \___ 500 LOC documentation
+// Sample code 140 LOC /
+// Truetype parsing 580 LOC ---- 600 LOC TrueType
+// Software rasterization 240 LOC \ .
+// Curve tesselation 120 LOC \__ 500 LOC Bitmap creation
+// Bitmap management 70 LOC /
+// Baked bitmap interface 70 LOC /
+// Font name matching & access 150 LOC ---- 150
+// C runtime library abstraction 60 LOC ---- 60
+
+
+//////////////////////////////////////////////////////////////////////////////
+//////////////////////////////////////////////////////////////////////////////
+////
+//// SAMPLE PROGRAMS
+////
+//
+// Incomplete text-in-3d-api example, which draws quads properly aligned to be lossless
+//
+#if 0
+#define STB_TRUETYPE_IMPLEMENTATION // force following include to generate implementation
+#include "stb_truetype.h"
+
+char ttf_buffer[1<<20];
+unsigned char temp_bitmap[512*512];
+
+stbtt_chardata cdata[96]; // ASCII 32..126 is 95 glyphs
+GLstbtt_uint ftex;
+
+void my_stbtt_initfont(void)
+{
+ fread(ttf_buffer, 1, 1<<20, fopen("c:/windows/fonts/times.ttf", "rb"));
+ stbtt_BakeFontBitmap(data,0, 32.0, temp_bitmap,512,512, 32,96, cdata); // no guarantee this fits!
+ // can free ttf_buffer at this point
+ glGenTextures(1, &ftex);
+ glBindTexture(GL_TEXTURE_2D, ftex);
+ glTexImage2D(GL_TEXTURE_2D, 0, GL_ALPHA, 512,512, 0, GL_ALPHA, GL_UNSIGNED_BYTE, temp_bitmap);
+ // can free temp_bitmap at this point
+ glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_LINEAR);
+}
+
+void my_stbtt_print(float x, float y, char *text)
+{
+ // assume orthographic projection with units = screen pixels, origin at top left
+ glBindTexture(GL_TEXTURE_2D, ftex);
+ glBegin(GL_QUADS);
+ while (*text) {
+ if (*text >= 32 && *text < 128) {
+ stbtt_aligned_quad q;
+ stbtt_GetBakedQuad(cdata, 512,512, *text-32, &x,&y,&q,1);//1=opengl,0=old d3d
+ glTexCoord2f(q.s0,q.t1); glVertex2f(q.x0,q.y0);
+ glTexCoord2f(q.s1,q.t1); glVertex2f(q.x1,q.y0);
+ glTexCoord2f(q.s1,q.t0); glVertex2f(q.x1,q.y1);
+ glTexCoord2f(q.s0,q.t0); glVertex2f(q.x0,q.y1);
+ }
+ ++text;
+ }
+ glEnd();
+}
+#endif
+//
+//
+//////////////////////////////////////////////////////////////////////////////
+//
+// Complete program (this compiles): get a single bitmap, print as ASCII art
+//
+#if 0
+#include
+#define STB_TRUETYPE_IMPLEMENTATION // force following include to generate implementation
+#include "stb_truetype.h"
+
+char ttf_buffer[1<<25];
+
+int main(int argc, char **argv)
+{
+ stbtt_fontinfo font;
+ unsigned char *bitmap;
+ int w,h,i,j,c = (argc > 1 ? atoi(argv[1]) : 'a'), s = (argc > 2 ? atoi(argv[2]) : 20);
+
+ fread(ttf_buffer, 1, 1<<25, fopen(argc > 3 ? argv[3] : "c:/windows/fonts/arialbd.ttf", "rb"));
+
+ stbtt_InitFont(&font, ttf_buffer, stbtt_GetFontOffsetForIndex(ttf_buffer,0));
+ bitmap = stbtt_GetCodepointBitmap(&font, 0,stbtt_ScaleForPixelHeight(&font, s), c, &w, &h, 0,0);
+
+ for (j=0; j < h; ++j) {
+ for (i=0; i < w; ++i)
+ putchar(" .:ioVM@"[bitmap[j*w+i]>>5]);
+ putchar('\n');
+ }
+ return 0;
+}
+#endif
+//
+// Output:
+//
+// .ii.
+// @@@@@@.
+// V@Mio@@o
+// :i. V@V
+// :oM@@M
+// :@@@MM@M
+// @@o o@M
+// :@@. M@M
+// @@@o@@@@
+// :M@@V:@@.
+//
+//////////////////////////////////////////////////////////////////////////////
+//
+// Complete program: print "Hello World!" banner, with bugs
+//
+#if 0
+int main(int arg, char **argv)
+{
+ unsigned char screen[20][79];
+ int i,j, pos=0;
+ float scale;
+ char *text = "Heljo World!";
+
+ fread(buffer, 1, 1000000, fopen("c:/windows/fonts/arialbd.ttf", "rb"));
+ stbtt_InitFont(&font, buffer, 0);
+
+ scale = stbtt_ScaleForPixelHeight(&font, 16);
+ memset(screen, 0, sizeof(screen));
+
+ while (*text) {
+ int advance,lsb,x0,y0,x1,y1, newpos, baseline=13;
+ stbtt_GetCodepointHMetrics(&font, *text, &advance, &lsb);
+ stbtt_GetCodepointBitmapBox(&font, *text, scale,scale, &x0,&y0,&x1,&y1);
+ newpos = pos + (int) (lsb * scale) + x0;
+ stbtt_MakeCodepointBitmap(&font, &screen[baseline + y0][newpos], x1-x0,y1-y0, 79, scale,scale, *text);
+ // note that this stomps the old data, so where character boxes overlap (e.g. 'lj') it's wrong
+ // because this API is really for baking character bitmaps into textures
+ pos += (int) (advance * scale);
+ ++text;
+ }
+
+ for (j=0; j < 20; ++j) {
+ for (i=0; i < 79; ++i)
+ putchar(" .:ioVM@"[screen[j][i]>>5]);
+ putchar('\n');
+ }
+
+ return 0;
+}
+#endif
+
+
+//////////////////////////////////////////////////////////////////////////////
+//////////////////////////////////////////////////////////////////////////////
+////
+//// INTEGRATION WITH RUNTIME LIBRARIES
+////
+
+#ifdef STB_TRUETYPE_IMPLEMENTATION
+ // #define your own (u)stbtt_int8/16/32 before including to override this
+ #ifndef stbtt_uint8
+ typedef unsigned char stbtt_uint8;
+ typedef signed char stbtt_int8;
+ typedef unsigned short stbtt_uint16;
+ typedef signed short stbtt_int16;
+ typedef unsigned int stbtt_uint32;
+ typedef signed int stbtt_int32;
+ #endif
+
+ typedef char stbtt__check_size32[sizeof(stbtt_int32)==4 ? 1 : -1];
+ typedef char stbtt__check_size16[sizeof(stbtt_int16)==2 ? 1 : -1];
+
+ // #define your own STBTT_sort() to override this to avoid qsort
+ #ifndef STBTT_sort
+ #include
+ #define STBTT_sort(data,num_items,item_size,compare_func) qsort(data,num_items,item_size,compare_func)
+ #endif
+
+ // #define your own STBTT_ifloor/STBTT_iceil() to avoid math.h
+ #ifndef STBTT_ifloor
+ #include
+ #define STBTT_ifloor(x) ((int) floor(x))
+ #define STBTT_iceil(x) ((int) ceil(x))
+ #endif
+
+ // #define your own functions "STBTT_malloc" / "STBTT_free" to avoid malloc.h
+ #ifndef STBTT_malloc
+ #include
+ #define STBTT_malloc(x,u) malloc(x)
+ #define STBTT_free(x,u) free(x)
+ #endif
+
+ #ifndef STBTT_assert
+ #include
+ #define STBTT_assert(x) assert(x)
+ #endif
+
+ #ifndef STBTT_strlen
+ #include
+ #define STBTT_strlen(x) strlen(x)
+ #endif
+
+ #ifndef STBTT_memcpy
+ #include
+ #define STBTT_memcpy memcpy
+ #define STBTT_memset memset
+ #endif
+#endif
+
+///////////////////////////////////////////////////////////////////////////////
+///////////////////////////////////////////////////////////////////////////////
+////
+//// INTERFACE
+////
+////
+
+#ifndef __STB_INCLUDE_STB_TRUETYPE_H__
+#define __STB_INCLUDE_STB_TRUETYPE_H__
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// TEXTURE BAKING API
+//
+// If you use this API, you only have to call two functions ever.
+//
+
+typedef struct
+{
+ unsigned short x0,y0,x1,y1; // coordinates of bbox in bitmap
+ float xoff,yoff,xadvance;
+} stbtt_bakedchar;
+
+extern int stbtt_BakeFontBitmap(const unsigned char *data, int offset, // font location (use offset=0 for plain .ttf)
+ float pixel_height, // height of font in pixels
+ unsigned char *pixels, int pw, int ph, // bitmap to be filled in
+ int first_char, int num_chars, // characters to bake
+ stbtt_bakedchar *chardata); // you allocate this, it's num_chars long
+// if return is positive, the first unused row of the bitmap
+// if return is negative, returns the negative of the number of characters that fit
+// if return is 0, no characters fit and no rows were used
+// This uses a very crappy packing.
+
+typedef struct
+{
+ float x0,y0,s0,t0; // top-left
+ float x1,y1,s1,t1; // bottom-right
+} stbtt_aligned_quad;
+
+extern void stbtt_GetBakedQuad(stbtt_bakedchar *chardata, int pw, int ph, // same data as above
+ int char_index, // character to display
+ float *xpos, float *ypos, // pointers to current position in screen pixel space
+ stbtt_aligned_quad *q, // output: quad to draw
+ int opengl_fillrule); // true if opengl fill rule; false if DX9 or earlier
+// Call GetBakedQuad with char_index = 'character - first_char', and it
+// creates the quad you need to draw and advances the current position.
+// It's inefficient; you might want to c&p it and optimize it.
+
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// FONT LOADING
+//
+//
+
+extern int stbtt_GetFontOffsetForIndex(const unsigned char *data, int index);
+// Each .ttf file may have more than one font. Each has a sequential index
+// number starting from 0. Call this function to get the font offset for a
+// given index; it returns -1 if the index is out of range. A regular .ttf
+// file will only define one font and it always be at offset 0, so it will
+// return '0' for index 0, and -1 for all other indices. You can just skip
+// this step if you know it's that kind of font.
+
+
+// The following structure is defined publically so you can declare one on
+// the stack or as a global or etc.
+typedef struct
+{
+ void *userdata;
+ unsigned char *data; // pointer to .ttf file
+ int fontstart; // offset of start of font
+
+ int numGlyphs; // number of glyphs, needed for range checking
+
+ int loca,head,glyf,hhea,hmtx; // table locations as offset from start of .ttf
+ int index_map; // a cmap mapping for our chosen character encoding
+ int indexToLocFormat; // format needed to map from glyph index to glyph
+} stbtt_fontinfo;
+
+extern int stbtt_InitFont(stbtt_fontinfo *info, const unsigned char *data, int offset);
+// Given an offset into the file that defines a font, this function builds
+// the necessary cached info for the rest of the system. You must allocate
+// the stbtt_fontinfo yourself, and stbtt_InitFont will fill it out. You don't
+// need to do anything special to free it, because the contents are a pure
+// cache with no additional data structures. Returns 0 on failure.
+
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// CHARACTER TO GLYPH-INDEX CONVERSIOn
+
+int stbtt_FindGlyphIndex(const stbtt_fontinfo *info, int unicode_codepoint);
+// If you're going to perform multiple operations on the same character
+// and you want a speed-up, call this function with the character you're
+// going to process, then use glyph-based functions instead of the
+// codepoint-based functions.
+
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// CHARACTER PROPERTIES
+//
+
+extern float stbtt_ScaleForPixelHeight(const stbtt_fontinfo *info, float pixels);
+// computes a scale factor to produce a font whose "height" is 'pixels' tall.
+// Height is measured as the distance from the highest ascender to the lowest
+// descender; in other words, it's equivalent to calling stbtt_GetFontVMetrics
+// and computing:
+// scale = pixels / (ascent - descent)
+// so if you prefer to measure height by the ascent only, use a similar calculation.
+
+extern void stbtt_GetFontVMetrics(const stbtt_fontinfo *info, int *ascent, int *descent, int *lineGap);
+// ascent is the coordinate above the baseline the font extends; descent
+// is the coordinate below the baseline the font extends (i.e. it is typically negative)
+// lineGap is the spacing between one row's descent and the next row's ascent...
+// so you should advance the vertical position by "*ascent - *descent + *lineGap"
+// these are expressed in unscaled coordinates
+
+extern void stbtt_GetCodepointHMetrics(const stbtt_fontinfo *info, int codepoint, int *advanceWidth, int *leftSideBearing);
+// leftSideBearing is the offset from the current horizontal position to the left edge of the character
+// advanceWidth is the offset from the current horizontal position to the next horizontal position
+// these are expressed in unscaled coordinates
+
+extern int stbtt_GetCodepointKernAdvance(const stbtt_fontinfo *info, int ch1, int ch2);
+// an additional amount to add to the 'advance' value between ch1 and ch2
+// @TODO; for now always returns 0!
+
+extern int stbtt_GetCodepointBox(const stbtt_fontinfo *info, int codepoint, int *x0, int *y0, int *x1, int *y1);
+// Gets the bounding box of the visible part of the glyph, in unscaled coordinates
+
+extern void stbtt_GetGlyphHMetrics(const stbtt_fontinfo *info, int glyph_index, int *advanceWidth, int *leftSideBearing);
+extern int stbtt_GetGlyphKernAdvance(const stbtt_fontinfo *info, int glyph1, int glyph2);
+extern int stbtt_GetGlyphBox(const stbtt_fontinfo *info, int glyph_index, int *x0, int *y0, int *x1, int *y1);
+// as above, but takes one or more glyph indices for greater efficiency
+
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// GLYPH SHAPES (you probably don't need these, but they have to go before
+// the bitmaps for C declaration-order reasons)
+//
+
+#ifndef STBTT_vmove // you can predefine these to use different values (but why?)
+ enum {
+ STBTT_vmove=1,
+ STBTT_vline,
+ STBTT_vcurve
+ };
+#endif
+
+#ifndef stbtt_vertex // you can predefine this to use different values
+ // (we share this with other code at RAD)
+ #define stbtt_vertex_type short // can't use stbtt_int16 because that's not visible in the header file
+ typedef struct
+ {
+ stbtt_vertex_type x,y,cx,cy;
+ unsigned char type,padding;
+ } stbtt_vertex;
+#endif
+
+extern int stbtt_GetCodepointShape(const stbtt_fontinfo *info, int unicode_codepoint, stbtt_vertex **vertices);
+extern int stbtt_GetGlyphShape(const stbtt_fontinfo *info, int glyph_index, stbtt_vertex **vertices);
+// returns # of vertices and fills *vertices with the pointer to them
+// these are expressed in "unscaled" coordinates
+
+extern void stbtt_FreeShape(const stbtt_fontinfo *info, stbtt_vertex *vertices);
+// frees the data allocated above
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// BITMAP RENDERING
+//
+
+extern void stbtt_FreeBitmap(unsigned char *bitmap, void *userdata);
+// frees the bitmap allocated below
+
+extern unsigned char *stbtt_GetCodepointBitmap(const stbtt_fontinfo *info, float scale_x, float scale_y, int codepoint, int *width, int *height, int *xoff, int *yoff);
+// allocates a large-enough single-channel 8bpp bitmap and renders the
+// specified character/glyph at the specified scale into it, with
+// antialiasing. 0 is no coverage (transparent), 255 is fully covered (opaque).
+// *width & *height are filled out with the width & height of the bitmap,
+// which is stored left-to-right, top-to-bottom.
+//
+// xoff/yoff are the offset it pixel space from the glyph origin to the top-left of the bitmap
+
+extern void stbtt_MakeCodepointBitmap(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, int codepoint);
+// the same as above, but you pass in storage for the bitmap in the form
+// of 'output', with row spacing of 'out_stride' bytes. the bitmap is
+// clipped to out_w/out_h bytes. call the next function to get the
+// height and width and positioning info
+
+extern void stbtt_GetCodepointBitmapBox(const stbtt_fontinfo *font, int codepoint, float scale_x, float scale_y, int *ix0, int *iy0, int *ix1, int *iy1);
+// get the bbox of the bitmap centered around the glyph origin; so the
+// bitmap width is ix1-ix0, height is iy1-iy0, and location to place
+// the bitmap top left is (leftSideBearing*scale,iy0).
+// (Note that the bitmap uses y-increases-down, but the shape uses
+// y-increases-up, so CodepointBitmapBox and CodepointBox are inverted.)
+
+extern unsigned char *stbtt_GetGlyphBitmap(const stbtt_fontinfo *info, float scale_x, float scale_y, int glyph, int *width, int *height, int *xoff, int *yoff);
+extern void stbtt_GetGlyphBitmapBox(const stbtt_fontinfo *font, int glyph, float scale_x, float scale_y, int *ix0, int *iy0, int *ix1, int *iy1);
+extern void stbtt_MakeGlyphBitmap(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, int glyph);
+
+//extern void stbtt_get_true_bbox(stbtt_vertex *vertices, int num_verts, float scale_x, float scale_y, int *ix0, int *iy0, int *ix1, int *iy1);
+
+// @TODO: don't expose this structure
+typedef struct
+{
+ int w,h,stride;
+ unsigned char *pixels;
+} stbtt__bitmap;
+
+extern void stbtt_Rasterize(stbtt__bitmap *result, float flatness_in_pixels, stbtt_vertex *vertices, int num_verts, float scale_x, float scale_y, int x_off, int y_off, int invert, void *userdata);
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// Finding the right font...
+//
+// You should really just solve this offline, keep your own tables
+// of what font is what, and don't try to get it out of the .ttf file.
+// That's because getting it out of the .ttf file is really hard, because
+// the names in the file can appear in many possible encodings, in many
+// possible languages, and e.g. if you need a case-insensitive comparison,
+// the details of that depend on the encoding & language in a complex way
+// (actually underspecified in truetype, but also gigantic).
+//
+// But you can use the provided functions in two possible ways:
+// stbtt_FindMatchingFont() will use *case-sensitive* comparisons on
+// unicode-encoded names to try to find the font you want;
+// you can run this before calling stbtt_InitFont()
+//
+// stbtt_GetFontNameString() lets you get any of the various strings
+// from the file yourself and do your own comparisons on them.
+// You have to have called stbtt_InitFont() first.
+
+
+extern int stbtt_FindMatchingFont(const unsigned char *fontdata, const char *name, int flags);
+// returns the offset (not index) of the font that matches, or -1 if none
+// if you use STBTT_MACSTYLE_DONTCARE, use a font name like "Arial Bold".
+// if you use any other flag, use a font name like "Arial"; this checks
+// the 'macStyle' header field; i don't know if fonts set this consistently
+#define STBTT_MACSTYLE_DONTCARE 0
+#define STBTT_MACSTYLE_BOLD 1
+#define STBTT_MACSTYLE_ITALIC 2
+#define STBTT_MACSTYLE_UNDERSCORE 4
+#define STBTT_MACSTYLE_NONE 8 // <= not same as 0, this makes us check the bitfield is 0
+
+extern int stbtt_CompareUTF8toUTF16_bigendian(const char *s1, int len1, const char *s2, int len2);
+// returns 1/0 whether the first string interpreted as utf8 is identical to
+// the second string interpreted as big-endian utf16... useful for strings from next func
+
+extern char *stbtt_GetFontNameString(const stbtt_fontinfo *font, int *length, int platformID, int encodingID, int languageID, int nameID);
+// returns the string (which may be big-endian double byte, e.g. for unicode)
+// and puts the length in bytes in *length.
+//
+// some of the values for the IDs are below; for more see the truetype spec:
+// http://developer.apple.com/textfonts/TTRefMan/RM06/Chap6name.html
+// http://www.microsoft.com/typography/otspec/name.htm
+
+enum { // platformID
+ STBTT_PLATFORM_ID_UNICODE =0,
+ STBTT_PLATFORM_ID_MAC =1,
+ STBTT_PLATFORM_ID_ISO =2,
+ STBTT_PLATFORM_ID_MICROSOFT =3
+};
+
+enum { // encodingID for STBTT_PLATFORM_ID_UNICODE
+ STBTT_UNICODE_EID_UNICODE_1_0 =0,
+ STBTT_UNICODE_EID_UNICODE_1_1 =1,
+ STBTT_UNICODE_EID_ISO_10646 =2,
+ STBTT_UNICODE_EID_UNICODE_2_0_BMP=3,
+ STBTT_UNICODE_EID_UNICODE_2_0_FULL=4,
+};
+
+enum { // encodingID for STBTT_PLATFORM_ID_MICROSOFT
+ STBTT_MS_EID_SYMBOL =0,
+ STBTT_MS_EID_UNICODE_BMP =1,
+ STBTT_MS_EID_SHIFTJIS =2,
+ STBTT_MS_EID_UNICODE_FULL =10,
+};
+
+enum { // encodingID for STBTT_PLATFORM_ID_MAC; same as Script Manager codes
+ STBTT_MAC_EID_ROMAN =0, STBTT_MAC_EID_ARABIC =4,
+ STBTT_MAC_EID_JAPANESE =1, STBTT_MAC_EID_HEBREW =5,
+ STBTT_MAC_EID_CHINESE_TRAD =2, STBTT_MAC_EID_GREEK =6,
+ STBTT_MAC_EID_KOREAN =3, STBTT_MAC_EID_RUSSIAN =7,
+};
+
+enum { // languageID for STBTT_PLATFORM_ID_MICROSOFT; same as LCID...
+ // problematic because there are e.g. 16 english LCIDs and 16 arabic LCIDs
+ STBTT_MS_LANG_ENGLISH =0x0409, STBTT_MS_LANG_ITALIAN =0x0410,
+ STBTT_MS_LANG_CHINESE =0x0804, STBTT_MS_LANG_JAPANESE =0x0411,
+ STBTT_MS_LANG_DUTCH =0x0413, STBTT_MS_LANG_KOREAN =0x0412,
+ STBTT_MS_LANG_FRENCH =0x040c, STBTT_MS_LANG_RUSSIAN =0x0419,
+ STBTT_MS_LANG_GERMAN =0x0407, STBTT_MS_LANG_SPANISH =0x0409,
+ STBTT_MS_LANG_HEBREW =0x040d, STBTT_MS_LANG_SWEDISH =0x041D,
+};
+
+enum { // languageID for STBTT_PLATFORM_ID_MAC
+ STBTT_MAC_LANG_ENGLISH =0 , STBTT_MAC_LANG_JAPANESE =11,
+ STBTT_MAC_LANG_ARABIC =12, STBTT_MAC_LANG_KOREAN =23,
+ STBTT_MAC_LANG_DUTCH =4 , STBTT_MAC_LANG_RUSSIAN =32,
+ STBTT_MAC_LANG_FRENCH =1 , STBTT_MAC_LANG_SPANISH =6 ,
+ STBTT_MAC_LANG_GERMAN =2 , STBTT_MAC_LANG_SWEDISH =5 ,
+ STBTT_MAC_LANG_HEBREW =10, STBTT_MAC_LANG_CHINESE_SIMPLIFIED =33,
+ STBTT_MAC_LANG_ITALIAN =3 , STBTT_MAC_LANG_CHINESE_TRAD =19,
+};
+
+#ifdef __cplusplus
+}
+#endif
+
+#endif // __STB_INCLUDE_STB_TRUETYPE_H__
+
+///////////////////////////////////////////////////////////////////////////////
+///////////////////////////////////////////////////////////////////////////////
+////
+//// IMPLEMENTATION
+////
+////
+
+#ifdef STB_TRUETYPE_IMPLEMENTATION
+
+//////////////////////////////////////////////////////////////////////////
+//
+// accessors to parse data from file
+//
+
+// on platforms that don't allow misaligned reads, if we want to allow
+// truetype fonts that aren't padded to alignment, define ALLOW_UNALIGNED_TRUETYPE
+
+#define ttBYTE(p) (* (stbtt_uint8 *) (p))
+#define ttCHAR(p) (* (stbtt_int8 *) (p))
+#define ttFixed(p) ttLONG(p)
+
+#if defined(STB_TRUETYPE_BIGENDIAN) && !defined(ALLOW_UNALIGNED_TRUETYPE)
+
+ #define ttUSHORT(p) (* (stbtt_uint16 *) (p))
+ #define ttSHORT(p) (* (stbtt_int16 *) (p))
+ #define ttULONG(p) (* (stbtt_uint32 *) (p))
+ #define ttLONG(p) (* (stbtt_int32 *) (p))
+
+#else
+
+ stbtt_uint16 ttUSHORT(const stbtt_uint8 *p) { return p[0]*256 + p[1]; }
+ stbtt_int16 ttSHORT(const stbtt_uint8 *p) { return p[0]*256 + p[1]; }
+ stbtt_uint32 ttULONG(const stbtt_uint8 *p) { return (p[0]<<24) + (p[1]<<16) + (p[2]<<8) + p[3]; }
+ stbtt_int32 ttLONG(const stbtt_uint8 *p) { return (p[0]<<24) + (p[1]<<16) + (p[2]<<8) + p[3]; }
+
+#endif
+
+#define stbtt_tag4(p,c0,c1,c2,c3) ((p)[0] == (c0) && (p)[1] == (c1) && (p)[2] == (c2) && (p)[3] == (c3))
+#define stbtt_tag(p,str) stbtt_tag4(p,str[0],str[1],str[2],str[3])
+
+static int stbtt__isfont(const stbtt_uint8 *font)
+{
+ // check the version number
+ if (stbtt_tag(font, "1")) return 1; // TrueType 1
+ if (stbtt_tag(font, "typ1")) return 1; // TrueType with type 1 font -- we don't support this!
+ if (stbtt_tag(font, "OTTO")) return 1; // OpenType with CFF
+ if (stbtt_tag4(font, 0,1,0,0)) return 1; // OpenType 1.0
+ return 0;
+}
+
+// @OPTIMIZE: binary search
+static stbtt_uint32 stbtt__find_table(stbtt_uint8 *data, stbtt_uint32 fontstart, const char *tag)
+{
+ stbtt_int32 num_tables = ttUSHORT(data+fontstart+4);
+ stbtt_uint32 tabledir = fontstart + 12;
+ stbtt_int32 i;
+ for (i=0; i < num_tables; ++i) {
+ stbtt_uint32 loc = tabledir + 16*i;
+ if (stbtt_tag(data+loc+0, tag))
+ return ttULONG(data+loc+8);
+ }
+ return 0;
+}
+
+int stbtt_GetFontOffsetForIndex(const unsigned char *font_collection, int index)
+{
+ // if it's just a font, there's only one valid index
+ if (stbtt__isfont(font_collection))
+ return index == 0 ? 0 : -1;
+
+ // check if it's a TTC
+ if (stbtt_tag(font_collection, "ttcf")) {
+ // version 1?
+ if (ttULONG(font_collection+4) == 0x00010000 || ttULONG(font_collection+4) == 0x00020000) {
+ stbtt_int32 n = ttLONG(font_collection+8);
+ if (index >= n)
+ return -1;
+ return ttULONG(font_collection+12+index*14);
+ }
+ }
+ return -1;
+}
+
+int stbtt_InitFont(stbtt_fontinfo *info, const unsigned char *data2, int fontstart)
+{
+ stbtt_uint8 *data = (stbtt_uint8 *) data2;
+ stbtt_uint32 cmap, t;
+ stbtt_int32 i,numTables;
+
+ info->data = data;
+ info->fontstart = fontstart;
+
+ cmap = stbtt__find_table(data, fontstart, "cmap");
+ info->loca = stbtt__find_table(data, fontstart, "loca");
+ info->head = stbtt__find_table(data, fontstart, "head");
+ info->glyf = stbtt__find_table(data, fontstart, "glyf");
+ info->hhea = stbtt__find_table(data, fontstart, "hhea");
+ info->hmtx = stbtt__find_table(data, fontstart, "hmtx");
+ if (!cmap || !info->loca || !info->head || !info->glyf || !info->hhea || !info->hmtx)
+ return 0;
+
+ t = stbtt__find_table(data, fontstart, "maxp");
+ if (t)
+ info->numGlyphs = ttUSHORT(data+t+4);
+ else
+ info->numGlyphs = 0xffff;
+
+ // find a cmap encoding table we understand *now* to avoid searching
+ // later. (todo: could make this installable)
+ // the same regardless of glyph.
+ numTables = ttUSHORT(data + cmap + 2);
+ info->index_map = 0;
+ for (i=0; i < numTables; ++i) {
+ stbtt_uint32 encoding_record = cmap + 4 + 8 * i;
+ // find an encoding we understand:
+ switch(ttUSHORT(data+encoding_record)) {
+ case STBTT_PLATFORM_ID_MICROSOFT:
+ switch (ttUSHORT(data+encoding_record+2)) {
+ case STBTT_MS_EID_UNICODE_BMP:
+ case STBTT_MS_EID_UNICODE_FULL:
+ // MS/Unicode
+ info->index_map = cmap + ttULONG(data+encoding_record+4);
+ break;
+ }
+ break;
+ }
+ }
+ if (info->index_map == 0)
+ return 0;
+
+ info->indexToLocFormat = ttUSHORT(data+info->head + 50);
+ return 1;
+}
+
+int stbtt_FindGlyphIndex(const stbtt_fontinfo *info, int unicode_codepoint)
+{
+ stbtt_uint8 *data = info->data;
+ stbtt_uint32 index_map = info->index_map;
+
+ stbtt_uint16 format = ttUSHORT(data + index_map + 0);
+ if (format == 0) { // apple byte encoding
+ stbtt_int32 bytes = ttUSHORT(data + index_map + 2);
+ if (unicode_codepoint < bytes-6)
+ return ttBYTE(data + index_map + 6 + unicode_codepoint);
+ return 0;
+ } else if (format == 6) {
+ stbtt_uint32 first = ttUSHORT(data + index_map + 6);
+ stbtt_uint32 count = ttUSHORT(data + index_map + 8);
+ if ((stbtt_uint32) unicode_codepoint >= first && (stbtt_uint32) unicode_codepoint < first+count)
+ return ttUSHORT(data + index_map + 10 + (unicode_codepoint - first)*2);
+ return 0;
+ } else if (format == 2) {
+ STBTT_assert(0); // @TODO: high-byte mapping for japanese/chinese/korean
+ return 0;
+ } else if (format == 4) { // standard mapping for windows fonts: binary search collection of ranges
+ stbtt_uint16 segcount = ttUSHORT(data+index_map+6) >> 1;
+ stbtt_uint16 searchRange = ttUSHORT(data+index_map+8) >> 1;
+ stbtt_uint16 entrySelector = ttUSHORT(data+index_map+10);
+ stbtt_uint16 rangeShift = ttUSHORT(data+index_map+12) >> 1;
+ stbtt_uint16 item, offset, start, end;
+
+ // do a binary search of the segments
+ stbtt_uint32 endCount = index_map + 14;
+ stbtt_uint32 search = endCount;
+
+ if (unicode_codepoint > 0xffff)
+ return 0;
+
+ // they lie from endCount .. endCount + segCount
+ // but searchRange is the nearest power of two, so...
+ if (unicode_codepoint >= ttUSHORT(data + search + rangeShift*2))
+ search += rangeShift*2;
+
+ // now decrement to bias correctly to find smallest
+ search -= 2;
+ while (entrySelector) {
+ stbtt_uint16 start, end;
+ searchRange >>= 1;
+ start = ttUSHORT(data + search + 2 + segcount*2 + 2);
+ end = ttUSHORT(data + search + 2);
+ start = ttUSHORT(data + search + searchRange*2 + segcount*2 + 2);
+ end = ttUSHORT(data + search + searchRange*2);
+ if (unicode_codepoint > end)
+ search += searchRange*2;
+ --entrySelector;
+ }
+ search += 2;
+
+ item = (stbtt_uint16) ((search - endCount) >> 1);
+
+ STBTT_assert(unicode_codepoint <= ttUSHORT(data + endCount + 2*item));
+ start = ttUSHORT(data + index_map + 14 + segcount*2 + 2 + 2*item);
+ end = ttUSHORT(data + index_map + 14 + 2 + 2*item);
+ if (unicode_codepoint < start)
+ return 0;
+
+ offset = ttUSHORT(data + index_map + 14 + segcount*6 + 2 + 2*item);
+ if (offset == 0)
+ return unicode_codepoint + ttSHORT(data + index_map + 14 + segcount*4 + 2 + 2*item);
+
+ return ttUSHORT(data + offset + (unicode_codepoint-start)*2 + index_map + 14 + segcount*6 + 2 + 2*item);
+ } else if (format == 12) {
+ stbtt_uint16 ngroups = ttUSHORT(data+index_map+6);
+ stbtt_int32 low,high;
+ low = 0; high = (stbtt_int32)ngroups;
+ // Binary search the right group.
+ while (low <= high) {
+ stbtt_int32 mid = low + ((high-low) >> 1); // rounds down, so low <= mid < high
+ stbtt_uint32 start_char = ttULONG(data+index_map+16+mid*12);
+ stbtt_uint32 end_char = ttULONG(data+index_map+16+mid*12+4);
+ if ((stbtt_uint32) unicode_codepoint < start_char)
+ high = mid-1;
+ else if ((stbtt_uint32) unicode_codepoint > end_char)
+ low = mid+1;
+ else {
+ stbtt_uint32 start_glyph = ttULONG(data+index_map+16+mid*12+8);
+ return start_glyph + unicode_codepoint-start_char;
+ }
+ }
+ return 0; // not found
+ }
+ // @TODO
+ STBTT_assert(0);
+ return 0;
+}
+
+int stbtt_GetCodepointShape(const stbtt_fontinfo *info, int unicode_codepoint, stbtt_vertex **vertices)
+{
+ return stbtt_GetGlyphShape(info, stbtt_FindGlyphIndex(info, unicode_codepoint), vertices);
+}
+
+static void stbtt_setvertex(stbtt_vertex *v, stbtt_uint8 type, stbtt_int16 x, stbtt_int16 y, stbtt_int16 cx, stbtt_int16 cy)
+{
+ v->type = type;
+ v->x = x;
+ v->y = y;
+ v->cx = cx;
+ v->cy = cy;
+}
+
+static int stbtt__GetGlyfOffset(const stbtt_fontinfo *info, int glyph_index)
+{
+ int g1,g2;
+
+ if (glyph_index >= info->numGlyphs) return -1; // glyph index out of range
+ if (info->indexToLocFormat >= 2) return -1; // unknown index->glyph map format
+
+ if (info->indexToLocFormat == 0) {
+ g1 = info->glyf + ttUSHORT(info->data + info->loca + glyph_index * 2) * 2;
+ g2 = info->glyf + ttUSHORT(info->data + info->loca + glyph_index * 2 + 2) * 2;
+ } else {
+ g1 = info->glyf + ttULONG (info->data + info->loca + glyph_index * 4);
+ g2 = info->glyf + ttULONG (info->data + info->loca + glyph_index * 4 + 4);
+ }
+
+ return g1==g2 ? -1 : g1; // if length is 0, return -1
+}
+
+int stbtt_GetGlyphBox(const stbtt_fontinfo *info, int glyph_index, int *x0, int *y0, int *x1, int *y1)
+{
+ int g = stbtt__GetGlyfOffset(info, glyph_index);
+ if (g < 0) return 0;
+
+ if (x0) *x0 = ttSHORT(info->data + g + 2);
+ if (y0) *y0 = ttSHORT(info->data + g + 4);
+ if (x1) *x1 = ttSHORT(info->data + g + 6);
+ if (y1) *y1 = ttSHORT(info->data + g + 8);
+ return 1;
+}
+
+int stbtt_GetCodepointBox(const stbtt_fontinfo *info, int codepoint, int *x0, int *y0, int *x1, int *y1)
+{
+ return stbtt_GetGlyphBox(info, stbtt_FindGlyphIndex(info,codepoint), x0,y0,x1,y1);
+}
+
+int stbtt_GetGlyphShape(const stbtt_fontinfo *info, int glyph_index, stbtt_vertex **pvertices)
+{
+ stbtt_int16 numberOfContours;
+ stbtt_uint8 *endPtsOfContours;
+ stbtt_uint8 *data = info->data;
+ stbtt_vertex *vertices=0;
+ int num_vertices=0;
+ int g = stbtt__GetGlyfOffset(info, glyph_index);
+
+ *pvertices = NULL;
+
+ if (g < 0) return 0;
+
+ numberOfContours = ttSHORT(data + g);
+
+ if (numberOfContours > 0) {
+ stbtt_uint8 flags=0,flagcount;
+ stbtt_int32 ins, i,j=0,m,n, next_move, was_off=0, off;
+ stbtt_int16 x,y,cx,cy,sx,sy;
+ stbtt_uint8 *points;
+ endPtsOfContours = (data + g + 10);
+ ins = ttUSHORT(data + g + 10 + numberOfContours * 2);
+ points = data + g + 10 + numberOfContours * 2 + 2 + ins;
+
+ n = 1+ttUSHORT(endPtsOfContours + numberOfContours*2-2);
+
+ m = n + numberOfContours; // a loose bound on how many vertices we might need
+ vertices = (stbtt_vertex *) STBTT_malloc(m * sizeof(vertices[0]), info->userdata);
+ if (vertices == 0)
+ return 0;
+
+ next_move = 0;
+ flagcount=0;
+
+ // in first pass, we load uninterpreted data into the allocated array
+ // above, shifted to the end of the array so we won't overwrite it when
+ // we create our final data starting from the front
+
+ off = m - n; // starting offset for uninterpreted data, regardless of how m ends up being calculated
+
+ // first load flags
+
+ for (i=0; i < n; ++i) {
+ if (flagcount == 0) {
+ flags = *points++;
+ if (flags & 8)
+ flagcount = *points++;
+ } else
+ --flagcount;
+ vertices[off+i].type = flags;
+ }
+
+ // now load x coordinates
+ x=0;
+ for (i=0; i < n; ++i) {
+ flags = vertices[off+i].type;
+ if (flags & 2) {
+ stbtt_int16 dx = *points++;
+ x += (flags & 16) ? dx : -dx; // ???
+ } else {
+ if (!(flags & 16)) {
+ x = x + (stbtt_int16) (points[0]*256 + points[1]);
+ points += 2;
+ }
+ }
+ vertices[off+i].x = x;
+ }
+
+ // now load y coordinates
+ y=0;
+ for (i=0; i < n; ++i) {
+ flags = vertices[off+i].type;
+ if (flags & 4) {
+ stbtt_int16 dy = *points++;
+ y += (flags & 32) ? dy : -dy; // ???
+ } else {
+ if (!(flags & 32)) {
+ y = y + (stbtt_int16) (points[0]*256 + points[1]);
+ points += 2;
+ }
+ }
+ vertices[off+i].y = y;
+ }
+
+ // now convert them to our format
+ num_vertices=0;
+ sx = sy = cx = cy = 0;
+ for (i=0; i < n; ++i) {
+ flags = vertices[off+i].type;
+ x = (stbtt_int16) vertices[off+i].x;
+ y = (stbtt_int16) vertices[off+i].y;
+ if (next_move == i) {
+ // when we get to the end, we have to close the shape explicitly
+ if (i != 0) {
+ if (was_off)
+ stbtt_setvertex(&vertices[num_vertices++], STBTT_vcurve,sx,sy,cx,cy);
+ else
+ stbtt_setvertex(&vertices[num_vertices++], STBTT_vline,sx,sy,0,0);
+ }
+
+ // now start the new one
+ stbtt_setvertex(&vertices[num_vertices++], STBTT_vmove,x,y,0,0);
+ next_move = 1 + ttUSHORT(endPtsOfContours+j*2);
+ ++j;
+ was_off = 0;
+ sx = x;
+ sy = y;
+ } else {
+ if (!(flags & 1)) { // if it's a curve
+ if (was_off) // two off-curve control points in a row means interpolate an on-curve midpoint
+ stbtt_setvertex(&vertices[num_vertices++], STBTT_vcurve, (cx+x)>>1, (cy+y)>>1, cx, cy);
+ cx = x;
+ cy = y;
+ was_off = 1;
+ } else {
+ if (was_off)
+ stbtt_setvertex(&vertices[num_vertices++], STBTT_vcurve, x,y, cx, cy);
+ else
+ stbtt_setvertex(&vertices[num_vertices++], STBTT_vline, x,y,0,0);
+ was_off = 0;
+ }
+ }
+ }
+ if (i != 0) {
+ if (was_off)
+ stbtt_setvertex(&vertices[num_vertices++], STBTT_vcurve,sx,sy,cx,cy);
+ else
+ stbtt_setvertex(&vertices[num_vertices++], STBTT_vline,sx,sy,0,0);
+ }
+ } else if (numberOfContours == -1) {
+ // Compound shapes.
+ int more = 1;
+ stbtt_uint8 *comp = data + g + 10;
+ num_vertices = 0;
+ vertices = 0;
+ while (more) {
+ stbtt_uint16 flags, gidx;
+ int comp_num_verts = 0, i;
+ stbtt_vertex *comp_verts = 0, *tmp = 0;
+ float mtx[6] = {1,0,0,1,0,0}, m, n;
+
+ flags = ttSHORT(comp); comp+=2;
+ gidx = ttSHORT(comp); comp+=2;
+
+ if (flags & 2) { // XY values
+ if (flags & 1) { // shorts
+ mtx[4] = ttSHORT(comp); comp+=2;
+ mtx[5] = ttSHORT(comp); comp+=2;
+ } else {
+ mtx[4] = ttCHAR(comp); comp+=1;
+ mtx[5] = ttCHAR(comp); comp+=1;
+ }
+ }
+ else {
+ // @TODO handle matching point
+ STBTT_assert(0);
+ }
+ if (flags & (1<<3)) { // WE_HAVE_A_SCALE
+ mtx[0] = mtx[3] = ttSHORT(comp)/16384.0f; comp+=2;
+ mtx[1] = mtx[2] = 0;
+ } else if (flags & (1<<6)) { // WE_HAVE_AN_X_AND_YSCALE
+ mtx[0] = ttSHORT(comp)/16384.0f; comp+=2;
+ mtx[1] = mtx[2] = 0;
+ mtx[3] = ttSHORT(comp)/16384.0f; comp+=2;
+ } else if (flags & (1<<7)) { // WE_HAVE_A_TWO_BY_TWO
+ mtx[0] = ttSHORT(comp)/16384.0f; comp+=2;
+ mtx[1] = ttSHORT(comp)/16384.0f; comp+=2;
+ mtx[2] = ttSHORT(comp)/16384.0f; comp+=2;
+ mtx[3] = ttSHORT(comp)/16384.0f; comp+=2;
+ }
+
+ // Find transformation scales.
+ m = (float) sqrt(mtx[0]*mtx[0] + mtx[1]*mtx[1]);
+ n = (float) sqrt(mtx[2]*mtx[2] + mtx[3]*mtx[3]);
+
+ // Get indexed glyph.
+ comp_num_verts = stbtt_GetGlyphShape(info, gidx, &comp_verts);
+ if (comp_num_verts > 0) {
+ // Transform vertices.
+ for (i = 0; i < comp_num_verts; ++i) {
+ stbtt_vertex* v = &comp_verts[i];
+ stbtt_vertex_type x,y;
+ x=v->x; y=v->y;
+ v->x = (stbtt_vertex_type)(m * (mtx[0]*x + mtx[2]*y + mtx[4]));
+ v->y = (stbtt_vertex_type)(n * (mtx[1]*x + mtx[3]*y + mtx[5]));
+ x=v->cx; y=v->cy;
+ v->cx = (stbtt_vertex_type)(m * (mtx[0]*x + mtx[2]*y + mtx[4]));
+ v->cy = (stbtt_vertex_type)(n * (mtx[1]*x + mtx[3]*y + mtx[5]));
+ }
+ // Append vertices.
+ tmp = (stbtt_vertex*)STBTT_malloc((num_vertices+comp_num_verts)*sizeof(stbtt_vertex), info->userdata);
+ if (!tmp) {
+ if (vertices) STBTT_free(vertices, info->userdata);
+ if (comp_verts) STBTT_free(comp_verts, info->userdata);
+ return 0;
+ }
+ if (num_vertices > 0) memcpy(tmp, vertices, num_vertices*sizeof(stbtt_vertex));
+ memcpy(tmp+num_vertices, comp_verts, comp_num_verts*sizeof(stbtt_vertex));
+ if (vertices) STBTT_free(vertices, info->userdata);
+ vertices = tmp;
+ STBTT_free(comp_verts, info->userdata);
+ num_vertices += comp_num_verts;
+ }
+ // More components ?
+ more = flags & (1<<5);
+ }
+ } else if (numberOfContours < 0) {
+ // @TODO other compound variations?
+ STBTT_assert(0);
+ } else {
+ // numberOfCounters == 0, do nothing
+ }
+
+ *pvertices = vertices;
+ return num_vertices;
+}
+
+void stbtt_GetGlyphHMetrics(const stbtt_fontinfo *info, int glyph_index, int *advanceWidth, int *leftSideBearing)
+{
+ stbtt_uint16 numOfLongHorMetrics = ttUSHORT(info->data+info->hhea + 34);
+ if (glyph_index < numOfLongHorMetrics) {
+ if (advanceWidth) *advanceWidth = ttSHORT(info->data + info->hmtx + 4*glyph_index);
+ if (leftSideBearing) *leftSideBearing = ttSHORT(info->data + info->hmtx + 4*glyph_index + 2);
+ } else {
+ if (advanceWidth) *advanceWidth = ttSHORT(info->data + info->hmtx + 4*(numOfLongHorMetrics-1));
+ if (leftSideBearing) *leftSideBearing = ttSHORT(info->data + info->hmtx + 4*numOfLongHorMetrics + 2*(glyph_index - numOfLongHorMetrics));
+ }
+}
+
+int stbtt_GetGlyphKernAdvance(const stbtt_fontinfo * /*info*/, int /*glyph1*/, int /*glyph2*/)
+{
+ return 0;
+}
+
+int stbtt_GetCodepointKernAdvance(const stbtt_fontinfo * /*info*/, int /*ch1*/, int /*ch2*/)
+{
+ return 0;
+}
+
+void stbtt_GetCodepointHMetrics(const stbtt_fontinfo *info, int codepoint, int *advanceWidth, int *leftSideBearing)
+{
+ stbtt_GetGlyphHMetrics(info, stbtt_FindGlyphIndex(info,codepoint), advanceWidth, leftSideBearing);
+}
+
+void stbtt_GetFontVMetrics(const stbtt_fontinfo *info, int *ascent, int *descent, int *lineGap)
+{
+ if (ascent ) *ascent = ttSHORT(info->data+info->hhea + 4);
+ if (descent) *descent = ttSHORT(info->data+info->hhea + 6);
+ if (lineGap) *lineGap = ttSHORT(info->data+info->hhea + 8);
+}
+
+float stbtt_ScaleForPixelHeight(const stbtt_fontinfo *info, float height)
+{
+ int fheight = ttSHORT(info->data + info->hhea + 4) - ttSHORT(info->data + info->hhea + 6);
+ return (float) height / fheight;
+}
+
+void stbtt_FreeShape(const stbtt_fontinfo *info, stbtt_vertex *v)
+{
+ STBTT_free(v, info->userdata);
+}
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// antialiasing software rasterizer
+//
+
+void stbtt_GetGlyphBitmapBox(const stbtt_fontinfo *font, int glyph, float scale_x, float scale_y, int *ix0, int *iy0, int *ix1, int *iy1)
+{
+ int x0,y0,x1,y1;
+ if (!stbtt_GetGlyphBox(font, glyph, &x0,&y0,&x1,&y1))
+ x0=y0=x1=y1=0; // e.g. space character
+ // now move to integral bboxes (treating pixels as little squares, what pixels get touched)?
+ if (ix0) *ix0 = STBTT_ifloor(x0 * scale_x);
+ if (iy0) *iy0 = -STBTT_iceil (y1 * scale_y);
+ if (ix1) *ix1 = STBTT_iceil (x1 * scale_x);
+ if (iy1) *iy1 = -STBTT_ifloor(y0 * scale_y);
+}
+
+void stbtt_GetCodepointBitmapBox(const stbtt_fontinfo *font, int codepoint, float scale_x, float scale_y, int *ix0, int *iy0, int *ix1, int *iy1)
+{
+ stbtt_GetGlyphBitmapBox(font, stbtt_FindGlyphIndex(font,codepoint), scale_x, scale_y, ix0,iy0,ix1,iy1);
+}
+
+typedef struct stbtt__edge {
+ float x0,y0, x1,y1;
+ int invert;
+} stbtt__edge;
+
+typedef struct stbtt__active_edge
+{
+ int x,dx;
+ float ey;
+ struct stbtt__active_edge *next;
+ int valid;
+} stbtt__active_edge;
+
+#define FIXSHIFT 10
+#define FIX (1 << FIXSHIFT)
+#define FIXMASK (FIX-1)
+
+static stbtt__active_edge *new_active(stbtt__edge *e, int off_x, float start_point, void *userdata)
+{
+ stbtt__active_edge *z = (stbtt__active_edge *) STBTT_malloc(sizeof(*z), userdata); // @TODO: make a pool of these!!!
+ float dxdy = (e->x1 - e->x0) / (e->y1 - e->y0);
+ STBTT_assert(e->y0 <= start_point);
+ if (!z) return z;
+ // round dx down to avoid going too far
+ if (dxdy < 0)
+ z->dx = -STBTT_ifloor(FIX * -dxdy);
+ else
+ z->dx = STBTT_ifloor(FIX * dxdy);
+ z->x = STBTT_ifloor(FIX * (e->x0 + dxdy * (start_point - e->y0)));
+ z->x -= off_x * FIX;
+ z->ey = e->y1;
+ z->next = 0;
+ z->valid = e->invert ? 1 : -1;
+ return z;
+}
+
+// note: this routine clips fills that extend off the edges... ideally this
+// wouldn't happen, but it could happen if the truetype glyph bounding boxes
+// are wrong, or if the user supplies a too-small bitmap
+static void stbtt__fill_active_edges(unsigned char *scanline, int len, stbtt__active_edge *e, int max_weight)
+{
+ // non-zero winding fill
+ int x0=0, w=0;
+
+ while (e) {
+ if (w == 0) {
+ // if we're currently at zero, we need to record the edge start point
+ x0 = e->x; w += e->valid;
+ } else {
+ int x1 = e->x; w += e->valid;
+ // if we went to zero, we need to draw
+ if (w == 0) {
+ int i = x0 >> FIXSHIFT;
+ int j = x1 >> FIXSHIFT;
+
+ if (i < len && j >= 0) {
+ if (i == j) {
+ // x0,x1 are the same pixel, so compute combined coverage
+ scanline[i] = scanline[i] + (stbtt_uint8) ((x1 - x0) * max_weight >> FIXSHIFT);
+ } else {
+ if (i >= 0) // add antialiasing for x0
+ scanline[i] = scanline[i] + (stbtt_uint8) (((FIX - (x0 & FIXMASK)) * max_weight) >> FIXSHIFT);
+ else
+ i = -1; // clip
+
+ if (j < len) // add antialiasing for x1
+ scanline[j] = scanline[j] + (stbtt_uint8) (((x1 & FIXMASK) * max_weight) >> FIXSHIFT);
+ else
+ j = len; // clip
+
+ for (++i; i < j; ++i) // fill pixels between x0 and x1
+ scanline[i] = scanline[i] + (stbtt_uint8) max_weight;
+ }
+ }
+ }
+ }
+
+ e = e->next;
+ }
+}
+
+static void stbtt__rasterize_sorted_edges(stbtt__bitmap *result, stbtt__edge *e, int n, int vsubsample, int off_x, int off_y, void *userdata)
+{
+ stbtt__active_edge *active = NULL;
+ int y,j=0;
+ int max_weight = (255 / vsubsample); // weight per vertical scanline
+ int s; // vertical subsample index
+ unsigned char scanline_data[512], *scanline;
+
+ if (result->w > 512)
+ scanline = (unsigned char *) STBTT_malloc(result->w, userdata);
+ else
+ scanline = scanline_data;
+
+ y = off_y * vsubsample;
+ e[n].y0 = (off_y + result->h) * (float) vsubsample + 1;
+
+ while (j < result->h) {
+ STBTT_memset(scanline, 0, result->w);
+ for (s=0; s < vsubsample; ++s) {
+ // find center of pixel for this scanline
+ float scan_y = y + 0.5f;
+ stbtt__active_edge **step = &active;
+
+ // update all active edges;
+ // remove all active edges that terminate before the center of this scanline
+ while (*step) {
+ stbtt__active_edge * z = *step;
+ if (z->ey <= scan_y) {
+ *step = z->next; // delete from list
+ STBTT_assert(z->valid);
+ z->valid = 0;
+ STBTT_free(z, userdata);
+ } else {
+ z->x += z->dx; // advance to position for current scanline
+ step = &((*step)->next); // advance through list
+ }
+ }
+
+ // resort the list if needed
+ for(;;) {
+ int changed=0;
+ step = &active;
+ while (*step && (*step)->next) {
+ if ((*step)->x > (*step)->next->x) {
+ stbtt__active_edge *t = *step;
+ stbtt__active_edge *q = t->next;
+
+ t->next = q->next;
+ q->next = t;
+ *step = q;
+ changed = 1;
+ }
+ step = &(*step)->next;
+ }
+ if (!changed) break;
+ }
+
+ // insert all edges that start before the center of this scanline -- omit ones that also end on this scanline
+ while (e->y0 <= scan_y) {
+ if (e->y1 > scan_y) {
+ stbtt__active_edge *z = new_active(e, off_x, scan_y, userdata);
+ // find insertion point
+ if (active == NULL)
+ active = z;
+ else if (z->x < active->x) {
+ // insert at front
+ z->next = active;
+ active = z;
+ } else {
+ // find thing to insert AFTER
+ stbtt__active_edge *p = active;
+ while (p->next && p->next->x < z->x)
+ p = p->next;
+ // at this point, p->next->x is NOT < z->x
+ z->next = p->next;
+ p->next = z;
+ }
+ }
+ ++e;
+ }
+
+ // now process all active edges in XOR fashion
+ if (active)
+ stbtt__fill_active_edges(scanline, result->w, active, max_weight);
+
+ ++y;
+ }
+ STBTT_memcpy(result->pixels + j * result->stride, scanline, result->w);
+ ++j;
+ }
+
+ while (active) {
+ stbtt__active_edge *z = active;
+ active = active->next;
+ STBTT_free(z, userdata);
+ }
+
+ if (scanline != scanline_data)
+ STBTT_free(scanline, userdata);
+}
+
+static int stbtt__edge_compare(const void *p, const void *q)
+{
+ stbtt__edge *a = (stbtt__edge *) p;
+ stbtt__edge *b = (stbtt__edge *) q;
+
+ if (a->y0 < b->y0) return -1;
+ if (a->y0 > b->y0) return 1;
+ return 0;
+}
+
+typedef struct
+{
+ float x,y;
+} stbtt__point;
+
+static void stbtt__rasterize(stbtt__bitmap *result, stbtt__point *pts, int *wcount, int windings, float scale_x, float scale_y, int off_x, int off_y, int invert, void *userdata)
+{
+ float y_scale_inv = invert ? -scale_y : scale_y;
+ stbtt__edge *e;
+ int n,i,j,k,m;
+ int vsubsample = result->h < 8 ? 15 : 5;
+ // vsubsample should divide 255 evenly; otherwise we won't reach full opacity
+
+ // now we have to blow out the windings into explicit edge lists
+ n = 0;
+ for (i=0; i < windings; ++i)
+ n += wcount[i];
+
+ e = (stbtt__edge *) STBTT_malloc(sizeof(*e) * (n+1), userdata); // add an extra one as a sentinel
+ if (e == 0) return;
+ n = 0;
+
+ m=0;
+ for (i=0; i < windings; ++i) {
+ stbtt__point *p = pts + m;
+ m += wcount[i];
+ j = wcount[i]-1;
+ for (k=0; k < wcount[i]; j=k++) {
+ int a=k,b=j;
+ // skip the edge if horizontal
+ if (p[j].y == p[k].y)
+ continue;
+ // add edge from j to k to the list
+ e[n].invert = 0;
+ if (invert ? p[j].y > p[k].y : p[j].y < p[k].y) {
+ e[n].invert = 1;
+ a=j,b=k;
+ }
+ e[n].x0 = p[a].x * scale_x;
+ e[n].y0 = p[a].y * y_scale_inv * vsubsample;
+ e[n].x1 = p[b].x * scale_x;
+ e[n].y1 = p[b].y * y_scale_inv * vsubsample;
+ ++n;
+ }
+ }
+
+ // now sort the edges by their highest point (should snap to integer, and then by x)
+ STBTT_sort(e, n, sizeof(e[0]), stbtt__edge_compare);
+
+ // now, traverse the scanlines and find the intersections on each scanline, use xor winding rule
+ stbtt__rasterize_sorted_edges(result, e, n, vsubsample, off_x, off_y, userdata);
+
+ STBTT_free(e, userdata);
+}
+
+static void stbtt__add_point(stbtt__point *points, int n, float x, float y)
+{
+ if (!points) return; // during first pass, it's unallocated
+ points[n].x = x;
+ points[n].y = y;
+}
+
+// tesselate until threshhold p is happy... @TODO warped to compensate for non-linear stretching
+static int stbtt__tesselate_curve(stbtt__point *points, int *num_points, float x0, float y0, float x1, float y1, float x2, float y2, float objspace_flatness_squared, int n)
+{
+ // midpoint
+ float mx = (x0 + 2*x1 + x2)/4;
+ float my = (y0 + 2*y1 + y2)/4;
+ // versus directly drawn line
+ float dx = (x0+x2)/2 - mx;
+ float dy = (y0+y2)/2 - my;
+ if (n > 16) // 65536 segments on one curve better be enough!
+ return 1;
+ if (dx*dx+dy*dy > objspace_flatness_squared) { // half-pixel error allowed... need to be smaller if AA
+ stbtt__tesselate_curve(points, num_points, x0,y0, (x0+x1)/2.0f,(y0+y1)/2.0f, mx,my, objspace_flatness_squared,n+1);
+ stbtt__tesselate_curve(points, num_points, mx,my, (x1+x2)/2.0f,(y1+y2)/2.0f, x2,y2, objspace_flatness_squared,n+1);
+ } else {
+ stbtt__add_point(points, *num_points,x2,y2);
+ *num_points = *num_points+1;
+ }
+ return 1;
+}
+
+// returns number of contours
+stbtt__point *stbtt_FlattenCurves(stbtt_vertex *vertices, int num_verts, float objspace_flatness, int **contour_lengths, int *num_contours, void *userdata)
+{
+ stbtt__point *points=0;
+ int num_points=0;
+
+ float objspace_flatness_squared = objspace_flatness * objspace_flatness;
+ int i,n=0,start=0, pass;
+
+ // count how many "moves" there are to get the contour count
+ for (i=0; i < num_verts; ++i)
+ if (vertices[i].type == STBTT_vmove)
+ ++n;
+
+ *num_contours = n;
+ if (n == 0) return 0;
+
+ *contour_lengths = (int *) STBTT_malloc(sizeof(**contour_lengths) * n, userdata);
+
+ if (*contour_lengths == 0) {
+ *num_contours = 0;
+ return 0;
+ }
+
+ // make two passes through the points so we don't need to realloc
+ for (pass=0; pass < 2; ++pass) {
+ float x=0,y=0;
+ if (pass == 1) {
+ points = (stbtt__point *) STBTT_malloc(num_points * sizeof(points[0]), userdata);
+ if (points == NULL) goto error;
+ }
+ num_points = 0;
+ n= -1;
+ for (i=0; i < num_verts; ++i) {
+ switch (vertices[i].type) {
+ case STBTT_vmove:
+ // start the next contour
+ if (n >= 0)
+ (*contour_lengths)[n] = num_points - start;
+ ++n;
+ start = num_points;
+
+ x = vertices[i].x, y = vertices[i].y;
+ stbtt__add_point(points, num_points++, x,y);
+ break;
+ case STBTT_vline:
+ x = vertices[i].x, y = vertices[i].y;
+ stbtt__add_point(points, num_points++, x, y);
+ break;
+ case STBTT_vcurve:
+ stbtt__tesselate_curve(points, &num_points, x,y,
+ vertices[i].cx, vertices[i].cy,
+ vertices[i].x, vertices[i].y,
+ objspace_flatness_squared, 0);
+ x = vertices[i].x, y = vertices[i].y;
+ break;
+ }
+ }
+ (*contour_lengths)[n] = num_points - start;
+ }
+
+ return points;
+error:
+ STBTT_free(points, userdata);
+ STBTT_free(*contour_lengths, userdata);
+ *contour_lengths = 0;
+ *num_contours = 0;
+ return NULL;
+}
+
+void stbtt_Rasterize(stbtt__bitmap *result, float flatness_in_pixels, stbtt_vertex *vertices, int num_verts, float scale_x, float scale_y, int x_off, int y_off, int invert, void *userdata)
+{
+ float scale = scale_x > scale_y ? scale_y : scale_x;
+ int winding_count, *winding_lengths;
+ stbtt__point *windings = stbtt_FlattenCurves(vertices, num_verts, flatness_in_pixels / scale, &winding_lengths, &winding_count, userdata);
+ if (windings) {
+ stbtt__rasterize(result, windings, winding_lengths, winding_count, scale_x, scale_y, x_off, y_off, invert, userdata);
+ STBTT_free(winding_lengths, userdata);
+ STBTT_free(windings, userdata);
+ }
+}
+
+void stbtt_FreeBitmap(unsigned char *bitmap, void *userdata)
+{
+ STBTT_free(bitmap, userdata);
+}
+
+unsigned char *stbtt_GetGlyphBitmap(const stbtt_fontinfo *info, float scale_x, float scale_y, int glyph, int *width, int *height, int *xoff, int *yoff)
+{
+ int ix0,iy0,ix1,iy1;
+ stbtt__bitmap gbm;
+ stbtt_vertex *vertices;
+ int num_verts = stbtt_GetGlyphShape(info, glyph, &vertices);
+
+ if (scale_x == 0) scale_x = scale_y;
+ if (scale_y == 0) {
+ if (scale_x == 0) return NULL;
+ scale_y = scale_x;
+ }
+
+ stbtt_GetGlyphBitmapBox(info, glyph, scale_x, scale_y, &ix0,&iy0,&ix1,&iy1);
+
+ // now we get the size
+ gbm.w = (ix1 - ix0);
+ gbm.h = (iy1 - iy0);
+ gbm.pixels = NULL; // in case we error
+
+ if (width ) *width = gbm.w;
+ if (height) *height = gbm.h;
+ if (xoff ) *xoff = ix0;
+ if (yoff ) *yoff = iy0;
+
+ if (gbm.w && gbm.h) {
+ gbm.pixels = (unsigned char *) STBTT_malloc(gbm.w * gbm.h, info->userdata);
+ if (gbm.pixels) {
+ gbm.stride = gbm.w;
+
+ stbtt_Rasterize(&gbm, 0.35f, vertices, num_verts, scale_x, scale_y, ix0, iy0, 1, info->userdata);
+ }
+ }
+ STBTT_free(vertices, info->userdata);
+ return gbm.pixels;
+}
+
+void stbtt_MakeGlyphBitmap(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, int glyph)
+{
+ int ix0,iy0;
+ stbtt_vertex *vertices;
+ int num_verts = stbtt_GetGlyphShape(info, glyph, &vertices);
+ stbtt__bitmap gbm;
+
+ stbtt_GetGlyphBitmapBox(info, glyph, scale_x, scale_y, &ix0,&iy0,0,0);
+ gbm.pixels = output;
+ gbm.w = out_w;
+ gbm.h = out_h;
+ gbm.stride = out_stride;
+
+ if (gbm.w && gbm.h)
+ stbtt_Rasterize(&gbm, 0.35f, vertices, num_verts, scale_x, scale_y, ix0,iy0, 1, info->userdata);
+
+ STBTT_free(vertices, info->userdata);
+}
+
+unsigned char *stbtt_GetCodepointBitmap(const stbtt_fontinfo *info, float scale_x, float scale_y, int codepoint, int *width, int *height, int *xoff, int *yoff)
+{
+ return stbtt_GetGlyphBitmap(info, scale_x, scale_y, stbtt_FindGlyphIndex(info,codepoint), width,height,xoff,yoff);
+}
+
+void stbtt_MakeCodepointBitmap(const stbtt_fontinfo *info, unsigned char *output, int out_w, int out_h, int out_stride, float scale_x, float scale_y, int codepoint)
+{
+ stbtt_MakeGlyphBitmap(info, output, out_w, out_h, out_stride, scale_x, scale_y, stbtt_FindGlyphIndex(info,codepoint));
+}
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// bitmap baking
+//
+// This is SUPER-SHITTY packing to keep source code small
+
+extern int stbtt_BakeFontBitmap(const unsigned char *data, int offset, // font location (use offset=0 for plain .ttf)
+ float pixel_height, // height of font in pixels
+ unsigned char *pixels, int pw, int ph, // bitmap to be filled in
+ int first_char, int num_chars, // characters to bake
+ stbtt_bakedchar *chardata)
+{
+ float scale;
+ int x,y,bottom_y, i;
+ stbtt_fontinfo f;
+ stbtt_InitFont(&f, data, offset);
+ STBTT_memset(pixels, 0, pw*ph); // background of 0 around pixels
+ x=y=1;
+ bottom_y = 1;
+
+ scale = stbtt_ScaleForPixelHeight(&f, pixel_height);
+
+ for (i=0; i < num_chars; ++i) {
+ int advance, lsb, x0,y0,x1,y1,gw,gh;
+ int g = stbtt_FindGlyphIndex(&f, first_char + i);
+ stbtt_GetGlyphHMetrics(&f, g, &advance, &lsb);
+ stbtt_GetGlyphBitmapBox(&f, g, scale,scale, &x0,&y0,&x1,&y1);
+ gw = x1-x0;
+ gh = y1-y0;
+ if (x + gw + 1 >= pw)
+ y = bottom_y, x = 1; // advance to next row
+ if (y + gh + 1 >= ph) // check if it fits vertically AFTER potentially moving to next row
+ return -i;
+ STBTT_assert(x+gw < pw);
+ STBTT_assert(y+gh < ph);
+ stbtt_MakeGlyphBitmap(&f, pixels+x+y*pw, gw,gh,pw, scale,scale, g);
+ chardata[i].x0 = (stbtt_int16) x;
+ chardata[i].y0 = (stbtt_int16) y;
+ chardata[i].x1 = (stbtt_int16) (x + gw);
+ chardata[i].y1 = (stbtt_int16) (y + gh);
+ chardata[i].xadvance = scale * advance;
+ chardata[i].xoff = (float) x0;
+ chardata[i].yoff = (float) y0;
+ x = x + gw + 2;
+ if (y+gh+2 > bottom_y)
+ bottom_y = y+gh+2;
+ }
+ return bottom_y;
+}
+
+void stbtt_GetBakedQuad(stbtt_bakedchar *chardata, int pw, int ph, int char_index, float *xpos, float *ypos, stbtt_aligned_quad *q, int opengl_fillrule)
+{
+ float d3d_bias = opengl_fillrule ? 0 : -0.5f;
+ float ipw = 1.0f / pw, iph = 1.0f / ph;
+ stbtt_bakedchar *b = chardata + char_index;
+ int round_x = STBTT_ifloor((*xpos + b->xoff) + 0.5);
+ int round_y = STBTT_ifloor((*ypos + b->yoff) + 0.5);
+
+ q->x0 = round_x + d3d_bias;
+ q->y0 = round_y + d3d_bias;
+ q->x1 = round_x + b->x1 - b->x0 + d3d_bias;
+ q->y1 = round_y + b->y1 - b->y0 + d3d_bias;
+
+ q->s0 = b->x0 * ipw;
+ q->t0 = b->y0 * ipw;
+ q->s1 = b->x1 * iph;
+ q->t1 = b->y1 * iph;
+
+ *xpos += b->xadvance;
+}
+
+//////////////////////////////////////////////////////////////////////////////
+//
+// font name matching -- recommended not to use this
+//
+
+// check if a utf8 string contains a prefix which is the utf16 string; if so return length of matching utf8 string
+static stbtt_int32 stbtt__CompareUTF8toUTF16_bigendian_prefix(stbtt_uint8 *s1, stbtt_int32 len1, stbtt_uint8 *s2, stbtt_int32 len2)
+{
+ stbtt_int32 i=0;
+
+ // convert utf16 to utf8 and compare the results while converting
+ while (len2) {
+ stbtt_uint16 ch = s2[0]*256 + s2[1];
+ if (ch < 0x80) {
+ if (i >= len1) return -1;
+ if (s1[i++] != ch) return -1;
+ } else if (ch < 0x800) {
+ if (i+1 >= len1) return -1;
+ if (s1[i++] != 0xc0 + (ch >> 6)) return -1;
+ if (s1[i++] != 0x80 + (ch & 0x3f)) return -1;
+ } else if (ch >= 0xd800 && ch < 0xdc00) {
+ stbtt_uint32 c;
+ stbtt_uint16 ch2 = s2[2]*256 + s2[3];
+ if (i+3 >= len1) return -1;
+ c = ((ch - 0xd800) << 10) + (ch2 - 0xdc00) + 0x10000;
+ if (s1[i++] != 0xf0 + (c >> 18)) return -1;
+ if (s1[i++] != 0x80 + ((c >> 12) & 0x3f)) return -1;
+ if (s1[i++] != 0x80 + ((c >> 6) & 0x3f)) return -1;
+ if (s1[i++] != 0x80 + ((c ) & 0x3f)) return -1;
+ s2 += 2; // plus another 2 below
+ len2 -= 2;
+ } else if (ch >= 0xdc00 && ch < 0xe000) {
+ return -1;
+ } else {
+ if (i+2 >= len1) return -1;
+ if (s1[i++] != 0xe0 + (ch >> 12)) return -1;
+ if (s1[i++] != 0x80 + ((ch >> 6) & 0x3f)) return -1;
+ if (s1[i++] != 0x80 + ((ch ) & 0x3f)) return -1;
+ }
+ s2 += 2;
+ len2 -= 2;
+ }
+ return i;
+}
+
+int stbtt_CompareUTF8toUTF16_bigendian(const char *s1, int len1, const char *s2, int len2)
+{
+ return len1 == stbtt__CompareUTF8toUTF16_bigendian_prefix((stbtt_uint8*) s1, len1, (stbtt_uint8*) s2, len2);
+}
+
+// returns results in whatever encoding you request... but note that 2-byte encodings
+// will be BIG-ENDIAN... use stbtt_CompareUTF8toUTF16_bigendian() to compare
+char *stbtt_GetFontNameString(const stbtt_fontinfo *font, int *length, int platformID, int encodingID, int languageID, int nameID)
+{
+ stbtt_int32 i,count,stringOffset;
+ stbtt_uint8 *fc = font->data;
+ stbtt_uint32 offset = font->fontstart;
+ stbtt_uint32 nm = stbtt__find_table(fc, offset, "name");
+ if (!nm) return NULL;
+
+ count = ttUSHORT(fc+nm+2);
+ stringOffset = nm + ttUSHORT(fc+nm+4);
+ for (i=0; i < count; ++i) {
+ stbtt_uint32 loc = nm + 6 + 12 * i;
+ if (platformID == ttUSHORT(fc+loc+0) && encodingID == ttUSHORT(fc+loc+2)
+ && languageID == ttUSHORT(fc+loc+4) && nameID == ttUSHORT(fc+loc+6)) {
+ *length = ttUSHORT(fc+loc+8);
+ return (char *) (fc+stringOffset+ttUSHORT(fc+loc+10));
+ }
+ }
+ return NULL;
+}
+
+static int stbtt__matchpair(stbtt_uint8 *fc, stbtt_uint32 nm, stbtt_uint8 *name, stbtt_int32 nlen, stbtt_int32 target_id, stbtt_int32 next_id)
+{
+ stbtt_int32 i;
+ stbtt_int32 count = ttUSHORT(fc+nm+2);
+ stbtt_int32 stringOffset = nm + ttUSHORT(fc+nm+4);
+
+ for (i=0; i < count; ++i) {
+ stbtt_uint32 loc = nm + 6 + 12 * i;
+ stbtt_int32 id = ttUSHORT(fc+loc+6);
+ if (id == target_id) {
+ // find the encoding
+ stbtt_int32 platform = ttUSHORT(fc+loc+0), encoding = ttUSHORT(fc+loc+2), language = ttUSHORT(fc+loc+4);
+
+ // is this a Unicode encoding?
+ if (platform == 0 || (platform == 3 && encoding == 1) || (platform == 3 && encoding == 10)) {
+ stbtt_int32 slen = ttUSHORT(fc+loc+8), off = ttUSHORT(fc+loc+10);
+
+ // check if there's a prefix match
+ stbtt_int32 matchlen = stbtt__CompareUTF8toUTF16_bigendian_prefix(name, nlen, fc+stringOffset+off,slen);
+ if (matchlen >= 0) {
+ // check for target_id+1 immediately following, with same encoding & language
+ if (i+1 < count && ttUSHORT(fc+loc+12+6) == next_id && ttUSHORT(fc+loc+12) == platform && ttUSHORT(fc+loc+12+2) == encoding && ttUSHORT(fc+loc+12+4) == language) {
+ stbtt_int32 slen = ttUSHORT(fc+loc+12+8), off = ttUSHORT(fc+loc+12+10);
+ if (slen == 0) {
+ if (matchlen == nlen)
+ return 1;
+ } else if (matchlen < nlen && name[matchlen] == ' ') {
+ ++matchlen;
+ if (stbtt_CompareUTF8toUTF16_bigendian((char*) (name+matchlen), nlen-matchlen, (char*)(fc+stringOffset+off),slen))
+ return 1;
+ }
+ } else {
+ // if nothing immediately following
+ if (matchlen == nlen)
+ return 1;
+ }
+ }
+ }
+
+ // @TODO handle other encodings
+ }
+ }
+ return 0;
+}
+
+static int stbtt__matches(stbtt_uint8 *fc, stbtt_uint32 offset, stbtt_uint8 *name, stbtt_int32 flags)
+{
+ stbtt_int32 nlen = STBTT_strlen((char *) name);
+ stbtt_uint32 nm,hd;
+ if (!stbtt__isfont(fc+offset)) return 0;
+
+ // check italics/bold/underline flags in macStyle...
+ if (flags) {
+ hd = stbtt__find_table(fc, offset, "head");
+ if ((ttUSHORT(fc+hd+44) & 7) != (flags & 7)) return 0;
+ }
+
+ nm = stbtt__find_table(fc, offset, "name");
+ if (!nm) return 0;
+
+ if (flags) {
+ // if we checked the macStyle flags, then just check the family and ignore the subfamily
+ if (stbtt__matchpair(fc, nm, name, nlen, 16, -1)) return 1;
+ if (stbtt__matchpair(fc, nm, name, nlen, 1, -1)) return 1;
+ if (stbtt__matchpair(fc, nm, name, nlen, 3, -1)) return 1;
+ } else {
+ if (stbtt__matchpair(fc, nm, name, nlen, 16, 17)) return 1;
+ if (stbtt__matchpair(fc, nm, name, nlen, 1, 2)) return 1;
+ if (stbtt__matchpair(fc, nm, name, nlen, 3, -1)) return 1;
+ }
+
+ return 0;
+}
+
+int stbtt_FindMatchingFont(const unsigned char *font_collection, const char *name_utf8, stbtt_int32 flags)
+{
+ stbtt_int32 i;
+ for (i=0;;++i) {
+ stbtt_int32 off = stbtt_GetFontOffsetForIndex(font_collection, i);
+ if (off < 0) return off;
+ if (stbtt__matches((stbtt_uint8 *) font_collection, off, (stbtt_uint8*) name_utf8, flags))
+ return off;
+ }
+}
+
+#endif // STB_TRUETYPE_IMPLEMENTATION
diff --git a/dep/recastnavigation/RecastDemo/Include/ChunkyTriMesh.h b/dep/recastnavigation/RecastDemo/Include/ChunkyTriMesh.h
new file mode 100644
index 000000000..9be77880f
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/ChunkyTriMesh.h
@@ -0,0 +1,52 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef CHUNKYTRIMESH_H
+#define CHUNKYTRIMESH_H
+
+struct rcChunkyTriMeshNode
+{
+ float bmin[2], bmax[2];
+ int i, n;
+};
+
+struct rcChunkyTriMesh
+{
+ inline rcChunkyTriMesh() : nodes(0), tris(0) {};
+ inline ~rcChunkyTriMesh() { delete [] nodes; delete [] tris; }
+
+ rcChunkyTriMeshNode* nodes;
+ int nnodes;
+ int* tris;
+ int ntris;
+ int maxTrisPerChunk;
+};
+
+// Creates partitioned triangle mesh (AABB tree),
+// where each node contains at max trisPerChunk triangles.
+bool rcCreateChunkyTriMesh(const float* verts, const int* tris, int ntris,
+ int trisPerChunk, rcChunkyTriMesh* cm);
+
+// Returns the chunk indices which overlap the input rectable.
+int rcGetChunksOverlappingRect(const rcChunkyTriMesh* cm, float bmin[2], float bmax[2], int* ids, const int maxIds);
+
+// Returns the chunk indices which overlap the input segment.
+int rcGetChunksOverlappingSegment(const rcChunkyTriMesh* cm, float p[2], float q[2], int* ids, const int maxIds);
+
+
+#endif // CHUNKYTRIMESH_H
diff --git a/dep/recastnavigation/RecastDemo/Include/ConvexVolumeTool.h b/dep/recastnavigation/RecastDemo/Include/ConvexVolumeTool.h
new file mode 100644
index 000000000..e3382305d
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/ConvexVolumeTool.h
@@ -0,0 +1,55 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef CONVEXVOLUMETOOL_H
+#define CONVEXVOLUMETOOL_H
+
+#include "Sample.h"
+
+// Tool to create convex volumess for InputGeom
+
+class ConvexVolumeTool : public SampleTool
+{
+ Sample* m_sample;
+ int m_areaType;
+ float m_boxHeight;
+ float m_boxDescent;
+
+ static const int MAX_PTS = 12;
+ float m_pts[MAX_PTS*3];
+ int m_npts;
+ int m_hull[MAX_PTS];
+ int m_nhull;
+
+public:
+ ConvexVolumeTool();
+ ~ConvexVolumeTool();
+
+ virtual int type() { return TOOL_CONVEX_VOLUME; }
+ virtual void init(Sample* sample);
+ virtual void reset();
+ virtual void handleMenu();
+ virtual void handleClick(const float* s, const float* p, bool shift);
+ virtual void handleToggle();
+ virtual void handleStep();
+ virtual void handleUpdate(const float dt);
+ virtual void handleRender();
+ virtual void handleRenderOverlay(double* proj, double* model, int* view);
+};
+
+#endif // CONVEXVOLUMETOOL_H
diff --git a/dep/recastnavigation/RecastDemo/Include/CrowdManager.h b/dep/recastnavigation/RecastDemo/Include/CrowdManager.h
new file mode 100644
index 000000000..faa642361
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/CrowdManager.h
@@ -0,0 +1,335 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef CROWDMANAGER_H
+#define CROWDMANAGER_H
+
+#include "DetourNavMeshQuery.h"
+#include "DetourObstacleAvoidance.h"
+#include "ValueHistory.h"
+
+
+class ProximityGrid
+{
+ int m_maxItems;
+ float m_cellSize;
+ float m_invCellSize;
+
+ struct Item
+ {
+ unsigned short id;
+ short x,y;
+ unsigned short next;
+ };
+ Item* m_pool;
+ int m_poolHead;
+ int m_poolSize;
+
+ unsigned short* m_buckets;
+ int m_bucketsSize;
+
+ int m_bounds[4];
+
+public:
+ ProximityGrid();
+ ~ProximityGrid();
+
+ bool init(const int maxItems, const float cellSize);
+
+ void clear();
+
+ void addItem(const unsigned short id,
+ const float minx, const float miny,
+ const float maxx, const float maxy);
+
+ int queryItems(const float minx, const float miny,
+ const float maxx, const float maxy,
+ unsigned short* ids, const int maxIds) const;
+
+ int getItemCountAt(const int x, const int y) const;
+ const int* getBounds() const { return m_bounds; }
+ const float getCellSize() const { return m_cellSize; }
+};
+
+
+
+
+static const unsigned int PATHQ_INVALID = 0;
+
+enum PathQueueRequestState
+{
+ PATHQ_STATE_INVALID,
+ PATHQ_STATE_WORKING,
+ PATHQ_STATE_READY,
+};
+
+typedef unsigned int PathQueueRef;
+
+class PathQueue
+{
+ static const int PQ_MAX_PATH = 256;
+
+ struct PathQuery
+ {
+ // Path find start and end location.
+ float startPos[3], endPos[3];
+ dtPolyRef startRef, endRef;
+ // Result.
+ dtPolyRef path[PQ_MAX_PATH];
+ bool ready;
+ int npath;
+ PathQueueRef ref;
+ const dtQueryFilter* filter; // TODO: This is potentially dangerous!
+ int keepalive;
+ };
+
+ static const int MAX_QUEUE = 8;
+ PathQuery m_queue[MAX_QUEUE];
+ PathQueueRef m_nextHandle;
+
+ int m_delay;
+
+public:
+ PathQueue();
+ ~PathQueue();
+
+ void update(dtNavMeshQuery* navquery);
+ PathQueueRef request(dtPolyRef startRef, dtPolyRef endRef,
+ const float* startPos, const float* endPos,
+ const dtQueryFilter* filter);
+ int getRequestState(PathQueueRef ref);
+ int getPathResult(PathQueueRef ref, dtPolyRef* path, const int maxPath);
+};
+
+
+class PathCorridor
+{
+ float m_pos[3];
+ float m_target[3];
+
+ dtPolyRef* m_path;
+ int m_npath;
+ int m_maxPath;
+
+public:
+ PathCorridor();
+ ~PathCorridor();
+
+ bool init(const int maxPath);
+
+ void reset(dtPolyRef ref, const float* pos);
+
+ int findCorners(float* cornerVerts, unsigned char* cornerFlags,
+ dtPolyRef* cornerPolys, const int maxCorners,
+ dtNavMeshQuery* navquery, const dtQueryFilter* filter);
+
+ void optimizePathVisibility(const float* next, const float pathOptimizationRange,
+ dtNavMeshQuery* navquery, const dtQueryFilter* filter);
+
+ bool optimizePathTopology(dtNavMeshQuery* navquery, const dtQueryFilter* filter);
+
+ void movePosition(const float* npos, dtNavMeshQuery* navquery, const dtQueryFilter* filter);
+ void moveTargetPosition(const float* npos, dtNavMeshQuery* navquery, const dtQueryFilter* filter);
+
+ void setCorridor(const float* target, const dtPolyRef* polys, const int npolys);
+
+ inline const float* getPos() const { return m_pos; }
+ inline const float* getTarget() const { return m_target; }
+
+ inline dtPolyRef getFirstPoly() const { return m_npath ? m_path[0] : 0; }
+
+ inline const dtPolyRef* getPath() const { return m_path; }
+ inline int getPathCount() const { return m_npath; }
+};
+
+
+class LocalBoundary
+{
+ static const int MAX_SEGS = 8;
+
+ struct Segment
+ {
+ float s[6]; // Segment start/end
+ float d; // Distance for pruning.
+ };
+
+ float m_center[3];
+ Segment m_segs[MAX_SEGS];
+ int m_nsegs;
+
+ void addSegment(const float dist, const float* seg);
+
+public:
+ LocalBoundary();
+ ~LocalBoundary();
+
+ void reset();
+
+ void update(dtPolyRef ref, const float* pos, const float collisionQueryRange,
+ dtNavMeshQuery* navquery, const dtQueryFilter* filter);
+
+ inline const float* getCenter() const { return m_center; }
+ inline int getSegmentCount() const { return m_nsegs; }
+ inline const float* getSegment(int i) const { return m_segs[i].s; }
+};
+
+
+static const int AGENT_MAX_NEIGHBOURS = 6;
+static const int AGENT_MAX_CORNERS = 4;
+static const int AGENT_MAX_TRAIL = 64;
+
+struct Neighbour
+{
+ int idx;
+ float dist;
+};
+
+struct Agent
+{
+ void integrate(const float maxAcc, const float dt);
+ void calcSmoothSteerDirection(float* dir);
+ void calcStraightSteerDirection(float* dir);
+ float getDistanceToGoal(const float range) const;
+
+ unsigned char active;
+
+ PathCorridor corridor;
+ LocalBoundary boundary;
+
+ float maxspeed;
+ float t;
+ float var;
+
+ float collisionQueryRange;
+ float pathOptimizationRange;
+
+ float topologyOptTime;
+
+ Neighbour neis[AGENT_MAX_NEIGHBOURS];
+ int nneis;
+
+ float radius, height;
+ float npos[3];
+ float disp[3];
+ float dvel[3];
+ float nvel[3];
+ float vel[3];
+
+ float cornerVerts[AGENT_MAX_CORNERS*3];
+ unsigned char cornerFlags[AGENT_MAX_CORNERS];
+ dtPolyRef cornerPolys[AGENT_MAX_CORNERS];
+ int ncorners;
+
+ float opts[3], opte[3];
+
+ float trail[AGENT_MAX_TRAIL*3];
+ int htrail;
+};
+
+
+enum UpdateFlags
+{
+ CROWDMAN_ANTICIPATE_TURNS = 1,
+ CROWDMAN_USE_VO = 2,
+ CROWDMAN_DRUNK = 4,
+ CROWDMAN_OPTIMIZE_VIS = 8,
+ CROWDMAN_OPTIMIZE_TOPO = 16,
+};
+
+
+class CrowdManager
+{
+ static const int MAX_AGENTS = 128;
+ Agent m_agents[MAX_AGENTS];
+ dtObstacleAvoidanceDebugData* m_vodebug[MAX_AGENTS];
+
+ dtObstacleAvoidanceQuery* m_obstacleQuery;
+ PathQueue m_pathq;
+ ProximityGrid m_grid;
+
+ dtPolyRef* m_pathResult;
+ int m_maxPathResult;
+
+ float m_ext[3];
+ dtQueryFilter m_filter;
+
+ int m_totalTime;
+ int m_rvoTime;
+ int m_sampleCount;
+
+ enum MoveRequestState
+ {
+ MR_TARGET_FAILED,
+ MR_TARGET_VALID,
+ MR_TARGET_REQUESTING,
+ MR_TARGET_WAITING_FOR_PATH,
+ MR_TARGET_ADJUST,
+ };
+
+ static const int MAX_TEMP_PATH = 32;
+
+ struct MoveRequest
+ {
+ unsigned char state; // State of the request
+ int idx; // Agent index
+ dtPolyRef ref; // Goal ref
+ float pos[3]; // Goal position
+ PathQueueRef pathqRef; // Path find query ref
+ dtPolyRef aref; // Goal adjustment ref
+ float apos[3]; // Goal adjustment pos
+ dtPolyRef temp[MAX_TEMP_PATH]; // Adjusted path to the goal
+ int ntemp;
+ };
+ MoveRequest m_moveRequests[MAX_AGENTS];
+ int m_moveRequestCount;
+
+ int getNeighbours(const float* pos, const float height, const float range,
+ const Agent* skip, Neighbour* result, const int maxResult);
+
+ void updateTopologyOptimization(const float dt, dtNavMeshQuery* navquery, const dtQueryFilter* filter);
+ void updateMoveRequest(const float dt, dtNavMeshQuery* navquery, const dtQueryFilter* filter);
+
+public:
+ CrowdManager();
+ ~CrowdManager();
+
+ void reset();
+ const Agent* getAgent(const int idx);
+ const int getAgentCount() const;
+ int addAgent(const float* pos, const float radius, const float height, dtNavMeshQuery* navquery);
+ void removeAgent(const int idx);
+
+ bool requestMoveTarget(const int idx, dtPolyRef ref, const float* pos);
+ bool adjustMoveTarget(const int idx, dtPolyRef ref, const float* pos);
+
+ int getActiveAgents(Agent** agents, const int maxAgents);
+ void update(const float dt, unsigned int flags, dtNavMeshQuery* navquery);
+
+ const dtQueryFilter* getFilter() const { return &m_filter; }
+ const float* getQueryExtents() const { return m_ext; }
+
+ const dtObstacleAvoidanceDebugData* getVODebugData(const int idx) const { return m_vodebug[idx]; }
+ inline int getTotalTime() const { return m_totalTime; }
+ inline int getRVOTime() const { return m_rvoTime; }
+ inline int getSampleCount() const { return m_sampleCount; }
+ const ProximityGrid* getGrid() const { return &m_grid; }
+
+};
+
+
+#endif // CROWDMANAGER_H
\ No newline at end of file
diff --git a/dep/recastnavigation/RecastDemo/Include/CrowdTool.h b/dep/recastnavigation/RecastDemo/Include/CrowdTool.h
new file mode 100644
index 000000000..1c69f6e74
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/CrowdTool.h
@@ -0,0 +1,88 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef CROWDTOOL_H
+#define CROWDTOOL_H
+
+#include "Sample.h"
+#include "DetourNavMesh.h"
+#include "DetourObstacleAvoidance.h"
+#include "ValueHistory.h"
+#include "CrowdManager.h"
+
+// Tool to create crowds.
+
+class CrowdTool : public SampleTool
+{
+ Sample* m_sample;
+ unsigned char m_oldFlags;
+
+ float m_targetPos[3];
+ dtPolyRef m_targetRef;
+
+ bool m_expandDebugDraw;
+ bool m_showLabels;
+ bool m_showCorners;
+ bool m_showTargets;
+ bool m_showCollisionSegments;
+ bool m_showPath;
+ bool m_showVO;
+ bool m_showOpt;
+ bool m_showGrid;
+ bool m_showNodes;
+ bool m_showPerfGraph;
+
+ bool m_expandOptions;
+ bool m_anticipateTurns;
+ bool m_optimizeVis;
+ bool m_optimizeTopo;
+ bool m_useVO;
+ bool m_drunkMove;
+
+ bool m_run;
+
+ CrowdManager m_crowd;
+
+ ValueHistory m_crowdTotalTime;
+ ValueHistory m_crowdRvoTime;
+ ValueHistory m_crowdSampleCount;
+
+ enum ToolMode
+ {
+ TOOLMODE_CREATE,
+ TOOLMODE_MOVE_TARGET,
+ };
+ ToolMode m_mode;
+
+public:
+ CrowdTool();
+ ~CrowdTool();
+
+ virtual int type() { return TOOL_CROWD; }
+ virtual void init(Sample* sample);
+ virtual void reset();
+ virtual void handleMenu();
+ virtual void handleClick(const float* s, const float* p, bool shift);
+ virtual void handleToggle();
+ virtual void handleStep();
+ virtual void handleUpdate(const float dt);
+ virtual void handleRender();
+ virtual void handleRenderOverlay(double* proj, double* model, int* view);
+};
+
+#endif // CROWDTOOL_H
diff --git a/dep/recastnavigation/RecastDemo/Include/Debug.h b/dep/recastnavigation/RecastDemo/Include/Debug.h
new file mode 100644
index 000000000..721fea117
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/Debug.h
@@ -0,0 +1,66 @@
+
+#ifndef _MMAP_DEBUG_H
+#define _MMAP_DEBUG_H
+
+#include
+#include "DetourNavMesh.h"
+#include "Recast.h"
+#include "ChunkyTriMesh.h"
+#include "MeshLoaderObj.h"
+
+//void duReadObjMesh(int mapID, rcInputGeom* geom);
+void duReadNavMesh(char* tile, dtNavMesh* &navMesh);
+int duReadHeightfield(char* tile, rcHeightfield* &hf);
+int duReadCompactHeightfield(char* tile, rcCompactHeightfield* &chf);
+int duReadContourSet(char* tile, rcContourSet* &cs);
+int duReadPolyMesh(char* tile, rcPolyMesh* &mesh);
+int duReadDetailMesh(char* tile, rcPolyMeshDetail* &mesh);
+
+class myMeshLoaderObj
+{
+private:
+ float* m_verts;
+ int* m_tris;
+ float* m_normals;
+ int m_vertCount;
+ int m_triCount;
+ char m_filename[260];
+
+public:
+ myMeshLoaderObj();
+ ~myMeshLoaderObj();
+
+ bool load(const char* fileName);
+
+ inline const float* getVerts() const { return m_verts; }
+ inline const float* getNormals() const { return m_normals; }
+ inline const int* getTris() const { return m_tris; }
+ inline int getVertCount() const { return m_vertCount; }
+ inline int getTriCount() const { return m_triCount; }
+ inline const char* getFileName() const { return m_filename; }
+};
+
+enum NavTerrain
+{
+ NAV_EMPTY = 0x00,
+ NAV_GROUND = 0x01,
+ NAV_MAGMA = 0x02,
+ NAV_SLIME = 0x04,
+ NAV_WATER = 0x08,
+ NAV_UNUSED1 = 0x10,
+ NAV_UNUSED2 = 0x20,
+ NAV_UNUSED3 = 0x40,
+ NAV_UNUSED4 = 0x80
+ // we only have 8 bits
+};
+
+struct MmapTileHeader
+{
+ unsigned int mmapMagic;
+ unsigned int dtVersion;
+ unsigned int mmapVersion;
+ unsigned int size;
+ bool usesLiquid : 1;
+};
+
+#endif
diff --git a/dep/recastnavigation/RecastDemo/Include/Filelist.h b/dep/recastnavigation/RecastDemo/Include/Filelist.h
new file mode 100644
index 000000000..63c85b122
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/Filelist.h
@@ -0,0 +1,35 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef FILELIST_H
+#define FILELIST_H
+
+struct FileList
+{
+ static const int MAX_FILES = 256;
+
+ FileList();
+ ~FileList();
+
+ char* files[MAX_FILES];
+ int size;
+};
+
+void scanDirectory(const char* path, const char* ext, FileList& list);
+
+#endif // FILELIST_H
diff --git a/dep/recastnavigation/RecastDemo/Include/InputGeom.h b/dep/recastnavigation/RecastDemo/Include/InputGeom.h
new file mode 100644
index 000000000..7b93f0036
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/InputGeom.h
@@ -0,0 +1,94 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef INPUTGEOM_H
+#define INPUTGEOM_H
+
+#include "ChunkyTriMesh.h"
+#include "MeshLoaderObj.h"
+#include "Debug.h"
+
+static const int MAX_CONVEXVOL_PTS = 12;
+struct ConvexVolume
+{
+ float verts[MAX_CONVEXVOL_PTS*3];
+ float hmin, hmax;
+ int nverts;
+ int area;
+};
+
+class InputGeom
+{
+ rcChunkyTriMesh* m_chunkyMesh;
+ myMeshLoaderObj* m_mesh;
+ float m_meshBMin[3], m_meshBMax[3];
+
+ // Off-Mesh connections.
+ static const int MAX_OFFMESH_CONNECTIONS = 256;
+ float m_offMeshConVerts[MAX_OFFMESH_CONNECTIONS*3*2];
+ float m_offMeshConRads[MAX_OFFMESH_CONNECTIONS];
+ unsigned char m_offMeshConDirs[MAX_OFFMESH_CONNECTIONS];
+ unsigned char m_offMeshConAreas[MAX_OFFMESH_CONNECTIONS];
+ unsigned short m_offMeshConFlags[MAX_OFFMESH_CONNECTIONS];
+ unsigned int m_offMeshConId[MAX_OFFMESH_CONNECTIONS];
+ int m_offMeshConCount;
+
+ // Convex Volumes.
+ static const int MAX_VOLUMES = 256;
+ ConvexVolume m_volumes[MAX_VOLUMES];
+ int m_volumeCount;
+
+public:
+ InputGeom();
+ ~InputGeom();
+
+ bool loadMesh(class rcContext* ctx, const char* filepath);
+
+ bool load(class rcContext* ctx, const char* filepath);
+ bool save(const char* filepath);
+
+ // Method to return static mesh data.
+ inline const myMeshLoaderObj* getMesh() const { return m_mesh; }
+ inline const float* getMeshBoundsMin() const { return m_meshBMin; }
+ inline const float* getMeshBoundsMax() const { return m_meshBMax; }
+ inline const rcChunkyTriMesh* getChunkyMesh() const { return m_chunkyMesh; }
+ bool raycastMesh(float* src, float* dst, float& tmin);
+
+ // Off-Mesh connections.
+ int getOffMeshConnectionCount() const { return m_offMeshConCount; }
+ const float* getOffMeshConnectionVerts() const { return m_offMeshConVerts; }
+ const float* getOffMeshConnectionRads() const { return m_offMeshConRads; }
+ const unsigned char* getOffMeshConnectionDirs() const { return m_offMeshConDirs; }
+ const unsigned char* getOffMeshConnectionAreas() const { return m_offMeshConAreas; }
+ const unsigned short* getOffMeshConnectionFlags() const { return m_offMeshConFlags; }
+ const unsigned int* getOffMeshConnectionId() const { return m_offMeshConId; }
+ void addOffMeshConnection(const float* spos, const float* epos, const float rad,
+ unsigned char bidir, unsigned char area, unsigned short flags);
+ void deleteOffMeshConnection(int i);
+ void drawOffMeshConnections(struct duDebugDraw* dd, bool hilight = false);
+
+ // Box Volumes.
+ int getConvexVolumeCount() const { return m_volumeCount; }
+ const ConvexVolume* getConvexVolumes() const { return m_volumes; }
+ void addConvexVolume(const float* verts, const int nverts,
+ const float minh, const float maxh, unsigned char area);
+ void deleteConvexVolume(int i);
+ void drawConvexVolumes(struct duDebugDraw* dd, bool hilight = false);
+};
+
+#endif // INPUTGEOM_H
diff --git a/dep/recastnavigation/RecastDemo/Include/MeshLoaderObj.h b/dep/recastnavigation/RecastDemo/Include/MeshLoaderObj.h
new file mode 100644
index 000000000..8e13e4959
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/MeshLoaderObj.h
@@ -0,0 +1,51 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef MESHLOADER_OBJ
+#define MESHLOADER_OBJ
+
+class rcMeshLoaderObj
+{
+public:
+ rcMeshLoaderObj();
+ ~rcMeshLoaderObj();
+
+ bool load(const char* fileName);
+
+ inline const float* getVerts() const { return m_verts; }
+ inline const float* getNormals() const { return m_normals; }
+ inline const int* getTris() const { return m_tris; }
+ inline int getVertCount() const { return m_vertCount; }
+ inline int getTriCount() const { return m_triCount; }
+ inline const char* getFileName() const { return m_filename; }
+
+private:
+
+ void addVertex(float x, float y, float z, int& cap);
+ void addTriangle(int a, int b, int c, int& cap);
+
+ char m_filename[260];
+
+ float* m_verts;
+ int* m_tris;
+ float* m_normals;
+ int m_vertCount;
+ int m_triCount;
+};
+
+#endif // MESHLOADER_OBJ
diff --git a/dep/recastnavigation/RecastDemo/Include/NavMeshTesterTool.h b/dep/recastnavigation/RecastDemo/Include/NavMeshTesterTool.h
new file mode 100644
index 000000000..51f16f7da
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/NavMeshTesterTool.h
@@ -0,0 +1,106 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef NAVMESHTESTERTOOL_H
+#define NAVMESHTESTERTOOL_H
+
+#include "Sample.h"
+#include "DetourNavMesh.h"
+#include "DetourNavMeshQuery.h"
+
+class NavMeshTesterTool : public SampleTool
+{
+ Sample* m_sample;
+
+ dtNavMesh* m_navMesh;
+ dtNavMeshQuery* m_navQuery;
+
+ dtQueryFilter m_filter;
+
+ dtStatus m_pathFindStatus;
+
+ enum ToolMode
+ {
+ TOOLMODE_PATHFIND_FOLLOW,
+ TOOLMODE_PATHFIND_STRAIGHT,
+ TOOLMODE_PATHFIND_SLICED,
+ TOOLMODE_RAYCAST,
+ TOOLMODE_DISTANCE_TO_WALL,
+ TOOLMODE_FIND_POLYS_IN_CIRCLE,
+ TOOLMODE_FIND_POLYS_IN_SHAPE,
+ TOOLMODE_FIND_LOCAL_NEIGHBOURHOOD,
+ };
+
+ ToolMode m_toolMode;
+
+ static const int MAX_POLYS = 256;
+ static const int MAX_SMOOTH = 2048;
+
+ dtPolyRef m_startRef;
+ dtPolyRef m_endRef;
+ dtPolyRef m_polys[MAX_POLYS];
+ dtPolyRef m_parent[MAX_POLYS];
+ int m_npolys;
+ float m_straightPath[MAX_POLYS*3];
+ unsigned char m_straightPathFlags[MAX_POLYS];
+ dtPolyRef m_straightPathPolys[MAX_POLYS];
+ int m_nstraightPath;
+ float m_polyPickExt[3];
+ float m_smoothPath[MAX_SMOOTH*3];
+ int m_nsmoothPath;
+ float m_queryPoly[4*3];
+
+ float m_spos[3];
+ float m_epos[3];
+ float m_hitPos[3];
+ float m_hitNormal[3];
+ bool m_hitResult;
+ float m_distanceToWall;
+ float m_neighbourhoodRadius;
+ bool m_sposSet;
+ bool m_eposSet;
+
+ int m_pathIterNum;
+ dtPolyRef m_pathIterPolys[MAX_POLYS];
+ int m_pathIterPolyCount;
+ float m_prevIterPos[3], m_iterPos[3], m_steerPos[3], m_targetPos[3];
+
+ static const int MAX_STEER_POINTS = 10;
+ float m_steerPoints[MAX_STEER_POINTS*3];
+ int m_steerPointCount;
+
+public:
+ NavMeshTesterTool();
+ ~NavMeshTesterTool();
+
+ virtual int type() { return TOOL_NAVMESH_TESTER; }
+ virtual void init(Sample* sample);
+ virtual void reset();
+ virtual void handleMenu();
+ virtual void handleClick(const float* s, const float* p, bool shift);
+ virtual void handleToggle();
+ virtual void handleStep();
+ virtual void handleUpdate(const float dt);
+ virtual void handleRender();
+ virtual void handleRenderOverlay(double* proj, double* model, int* view);
+
+ void recalc();
+ void drawAgent(const float* pos, float r, float h, float c, const unsigned int col);
+};
+
+#endif // NAVMESHTESTERTOOL_H
\ No newline at end of file
diff --git a/dep/recastnavigation/RecastDemo/Include/OffMeshConnectionTool.h b/dep/recastnavigation/RecastDemo/Include/OffMeshConnectionTool.h
new file mode 100644
index 000000000..1b5aefbf9
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/OffMeshConnectionTool.h
@@ -0,0 +1,50 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef OFFMESHCONNECTIONTOOL_H
+#define OFFMESHCONNECTIONTOOL_H
+
+#include "Sample.h"
+
+// Tool to create off-mesh connection for InputGeom
+
+class OffMeshConnectionTool : public SampleTool
+{
+ Sample* m_sample;
+ float m_hitPos[3];
+ bool m_hitPosSet;
+ bool m_bidir;
+ unsigned char m_oldFlags;
+
+public:
+ OffMeshConnectionTool();
+ ~OffMeshConnectionTool();
+
+ virtual int type() { return TOOL_OFFMESH_CONNECTION; }
+ virtual void init(Sample* sample);
+ virtual void reset();
+ virtual void handleMenu();
+ virtual void handleClick(const float* s, const float* p, bool shift);
+ virtual void handleToggle();
+ virtual void handleStep();
+ virtual void handleUpdate(const float dt);
+ virtual void handleRender();
+ virtual void handleRenderOverlay(double* proj, double* model, int* view);
+};
+
+#endif // OFFMESHCONNECTIONTOOL_H
diff --git a/dep/recastnavigation/RecastDemo/Include/PerfTimer.h b/dep/recastnavigation/RecastDemo/Include/PerfTimer.h
new file mode 100644
index 000000000..a5de026f5
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/PerfTimer.h
@@ -0,0 +1,32 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef PERFTIMER_H
+#define PERFTIMER_H
+
+#ifdef __GNUC__
+#include
+typedef int64_t TimeVal;
+#else
+typedef __int64 TimeVal;
+#endif
+
+TimeVal getPerfTime();
+int getPerfDeltaTimeUsec(const TimeVal start, const TimeVal end);
+
+#endif // PERFTIMER_H
\ No newline at end of file
diff --git a/dep/recastnavigation/RecastDemo/Include/SDLMain.h b/dep/recastnavigation/RecastDemo/Include/SDLMain.h
new file mode 100644
index 000000000..4683df57a
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/SDLMain.h
@@ -0,0 +1,11 @@
+/* SDLMain.m - main entry point for our Cocoa-ized SDL app
+ Initial Version: Darrell Walisser
+ Non-NIB-Code & other changes: Max Horn
+
+ Feel free to customize this file to suit your needs
+*/
+
+#import
+
+@interface SDLMain : NSObject
+@end
diff --git a/dep/recastnavigation/RecastDemo/Include/Sample.h b/dep/recastnavigation/RecastDemo/Include/Sample.h
new file mode 100644
index 000000000..77fe0ba89
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/Sample.h
@@ -0,0 +1,144 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef RECASTSAMPLE_H
+#define RECASTSAMPLE_H
+
+#include
+
+#include "Recast.h"
+#include "SampleInterfaces.h"
+
+
+// Tool types.
+enum SampleToolType
+{
+ TOOL_NONE = 0,
+ TOOL_TILE_EDIT,
+ TOOL_TILE_HIGHLIGHT,
+ TOOL_NAVMESH_TESTER,
+ TOOL_OFFMESH_CONNECTION,
+ TOOL_CONVEX_VOLUME,
+ TOOL_CROWD,
+};
+
+// These are just sample areas to use consistent values across the samples.
+// The use should specify these base on his needs.
+enum SamplePolyAreas
+{
+ SAMPLE_POLYAREA_GROUND,
+ SAMPLE_POLYAREA_WATER,
+ SAMPLE_POLYAREA_ROAD,
+ SAMPLE_POLYAREA_DOOR,
+ SAMPLE_POLYAREA_GRASS,
+ SAMPLE_POLYAREA_JUMP,
+};
+enum SamplePolyFlags
+{
+ SAMPLE_POLYFLAGS_WALK = 0x01, // Ability to walk (ground, grass, road)
+ SAMPLE_POLYFLAGS_SWIM = 0x02, // Ability to swim (water).
+ SAMPLE_POLYFLAGS_DOOR = 0x04, // Ability to move through doors.
+ SAMPLE_POLYFLAGS_JUMP = 0x08, // Ability to jump.
+ SAMPLE_POLYFLAGS_ALL = 0xffff // All abilities.
+};
+
+struct SampleTool
+{
+ virtual ~SampleTool() {}
+ virtual int type() = 0;
+ virtual void init(class Sample* sample) = 0;
+ virtual void reset() = 0;
+ virtual void handleMenu() = 0;
+ virtual void handleClick(const float* s, const float* p, bool shift) = 0;
+ virtual void handleRender() = 0;
+ virtual void handleRenderOverlay(double* proj, double* model, int* view) = 0;
+ virtual void handleToggle() = 0;
+ virtual void handleStep() = 0;
+ virtual void handleUpdate(const float dt) = 0;
+};
+
+
+class Sample
+{
+protected:
+ class InputGeom* m_geom;
+ class dtNavMesh* m_navMesh;
+ class dtNavMeshQuery* m_navQuery;
+ unsigned char m_navMeshDrawFlags;
+
+ float m_cellSize;
+ float m_cellHeight;
+ float m_agentHeight;
+ float m_agentRadius;
+ float m_agentMaxClimb;
+ float m_agentMaxSlope;
+ float m_regionMinSize;
+ float m_regionMergeSize;
+ float m_edgeMaxLen;
+ float m_edgeMaxError;
+ float m_vertsPerPoly;
+ float m_detailSampleDist;
+ float m_detailSampleMaxError;
+
+ SampleTool* m_tool;
+
+ BuildContext* m_ctx;
+
+ char m_meshName[128];
+
+public:
+ Sample();
+ virtual ~Sample();
+
+ void setContext(BuildContext* ctx) { m_ctx = ctx; }
+
+ void setTool(SampleTool* tool);
+
+ virtual void handleSettings();
+ virtual void handleTools();
+ virtual void handleDebugMode();
+ virtual void handleClick(const float* s, const float* p, bool shift);
+ virtual void handleToggle();
+ virtual void handleStep();
+ virtual void handleRender();
+ virtual void handleRenderOverlay(double* proj, double* model, int* view);
+ virtual void handleMeshChanged(class InputGeom* geom);
+ virtual bool handleBuild();
+ virtual void handleUpdate(const float dt);
+
+ virtual class InputGeom* getInputGeom() { return m_geom; }
+ virtual class dtNavMesh* getNavMesh() { return m_navMesh; }
+ virtual class dtNavMeshQuery* getNavMeshQuery() { return m_navQuery; }
+ virtual float getAgentRadius() { return m_agentRadius; }
+ virtual float getAgentHeight() { return m_agentHeight; }
+ virtual float getAgentClimb() { return m_agentMaxClimb; }
+ virtual const float* getBoundsMin();
+ virtual const float* getBoundsMax();
+
+ inline unsigned char getNavMeshDrawFlags() const { return m_navMeshDrawFlags; }
+ inline void setNavMeshDrawFlags(unsigned char flags) { m_navMeshDrawFlags = flags; }
+
+ void resetCommonSettings();
+ void handleCommonSettings();
+
+ inline void setMeshName(char* meshName) { memcpy(m_meshName, meshName, 128*sizeof(char)); }
+ inline char* getMeshName() { return m_meshName; }
+};
+
+
+#endif // RECASTSAMPLE_H
diff --git a/dep/recastnavigation/RecastDemo/Include/SampleInterfaces.h b/dep/recastnavigation/RecastDemo/Include/SampleInterfaces.h
new file mode 100644
index 000000000..bacbb2051
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/SampleInterfaces.h
@@ -0,0 +1,91 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef SAMPLEINTERFACES_H
+#define SAMPLEINTERFACES_H
+
+#include "DebugDraw.h"
+#include "Recast.h"
+#include "RecastDump.h"
+#include "PerfTimer.h"
+
+// These are example implementations of various interfaces used in Recast and Detour.
+
+// Recast build context.
+class BuildContext : public rcContext
+{
+ TimeVal m_startTime[RC_MAX_TIMERS];
+ int m_accTime[RC_MAX_TIMERS];
+
+ static const int MAX_MESSAGES = 1000;
+ const char* m_messages[MAX_MESSAGES];
+ int m_messageCount;
+ static const int TEXT_POOL_SIZE = 8000;
+ char m_textPool[TEXT_POOL_SIZE];
+ int m_textPoolSize;
+
+public:
+ BuildContext();
+ virtual ~BuildContext();
+
+ // Dumps the log to stdout.
+ void dumpLog(const char* format, ...);
+ // Returns number of log messages.
+ int getLogCount() const;
+ // Returns log message text.
+ const char* getLogText(const int i) const;
+
+protected:
+ // Virtual functions for custom implementations.
+ virtual void doResetLog();
+ virtual void doLog(const rcLogCategory /*category*/, const char* /*msg*/, const int /*len*/);
+ virtual void doResetTimers();
+ virtual void doStartTimer(const rcTimerLabel /*label*/);
+ virtual void doStopTimer(const rcTimerLabel /*label*/);
+ virtual int doGetAccumulatedTime(const rcTimerLabel /*label*/) const;
+};
+
+// OpenGL debug draw implementation.
+class DebugDrawGL : public duDebugDraw
+{
+public:
+ virtual void depthMask(bool state);
+ virtual void begin(duDebugDrawPrimitives prim, float size = 1.0f);
+ virtual void vertex(const float* pos, unsigned int color);
+ virtual void vertex(const float x, const float y, const float z, unsigned int color);
+ virtual void end();
+};
+
+// stdio file implementation.
+class FileIO : public duFileIO
+{
+ FILE* m_fp;
+ int m_mode;
+public:
+ FileIO();
+ virtual ~FileIO();
+ bool openForWrite(const char* path);
+ bool openForRead(const char* path);
+ virtual bool isWriting() const;
+ virtual bool isReading() const;
+ virtual bool write(const void* ptr, const size_t size);
+ virtual bool read(void* ptr, const size_t size);
+};
+
+#endif // SAMPLEINTERFACES_H
+
diff --git a/dep/recastnavigation/RecastDemo/Include/Sample_Debug.h b/dep/recastnavigation/RecastDemo/Include/Sample_Debug.h
new file mode 100644
index 000000000..8dfacc9b9
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/Sample_Debug.h
@@ -0,0 +1,71 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef RECASTSAMPLEDEBUG_H
+#define RECASTSAMPLEDEBUG_H
+
+#include "Sample_SoloMeshTiled.h"
+#include "DetourNavMesh.h"
+#include "Recast.h"
+
+// Sample used for random debugging.
+class Sample_Debug : public Sample_SoloMeshTiled
+{
+protected:
+ int m_hfCount;
+ rcHeightfield* m_hf;
+
+ int m_chfCount;
+ rcCompactHeightfield* m_chf;
+ rcContourSet* m_cset;
+
+ int m_csetCount;
+
+ int m_pmeshCount;
+ rcPolyMesh* m_pmeshes;
+
+ int m_dmeshCount;
+ rcPolyMeshDetail* m_dmeshes;
+
+ float m_ext[3];
+ float m_center[3];
+ float m_bmin[3], m_bmax[3];
+ dtPolyRef m_ref;
+
+public:
+ virtual void cleanup();
+ Sample_Debug();
+ virtual ~Sample_Debug();
+
+ virtual void handleSettings();
+ virtual void handleTools();
+ virtual void handleDebugMode();
+ virtual void handleClick(const float* p, bool shift);
+ virtual void handleToggle();
+ virtual void handleRender();
+ virtual void handleRenderOverlay(double* proj, double* model, int* view);
+ virtual void handleMeshChanged(class InputGeom* geom);
+ virtual bool handleBuild();
+ virtual void setHighlightedTile(const float* pos);
+
+ virtual const float* getBoundsMin();
+ virtual const float* getBoundsMax();
+};
+
+
+#endif // RECASTSAMPLE_H
diff --git a/dep/recastnavigation/RecastDemo/Include/Sample_SoloMeshSimple.h b/dep/recastnavigation/RecastDemo/Include/Sample_SoloMeshSimple.h
new file mode 100644
index 000000000..f9ce5d3e8
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/Sample_SoloMeshSimple.h
@@ -0,0 +1,81 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef RECASTSAMPLESOLOMESHSIMPLE_H
+#define RECASTSAMPLESOLOMESHSIMPLE_H
+
+#include "Sample.h"
+#include "DetourNavMesh.h"
+#include "Recast.h"
+
+class Sample_SoloMeshSimple : public Sample
+{
+protected:
+ bool m_keepInterResults;
+ float m_totalBuildTimeMs;
+
+ unsigned char* m_triareas;
+ rcHeightfield* m_solid;
+ rcCompactHeightfield* m_chf;
+ rcContourSet* m_cset;
+ rcPolyMesh* m_pmesh;
+ rcConfig m_cfg;
+ rcPolyMeshDetail* m_dmesh;
+
+ enum DrawMode
+ {
+ DRAWMODE_NAVMESH,
+ DRAWMODE_NAVMESH_TRANS,
+ DRAWMODE_NAVMESH_BVTREE,
+ DRAWMODE_NAVMESH_NODES,
+ DRAWMODE_NAVMESH_INVIS,
+ DRAWMODE_MESH,
+ DRAWMODE_VOXELS,
+ DRAWMODE_VOXELS_WALKABLE,
+ DRAWMODE_COMPACT,
+ DRAWMODE_COMPACT_DISTANCE,
+ DRAWMODE_COMPACT_REGIONS,
+ DRAWMODE_REGION_CONNECTIONS,
+ DRAWMODE_RAW_CONTOURS,
+ DRAWMODE_BOTH_CONTOURS,
+ DRAWMODE_CONTOURS,
+ DRAWMODE_POLYMESH,
+ DRAWMODE_POLYMESH_DETAIL,
+ MAX_DRAWMODE
+ };
+
+ DrawMode m_drawMode;
+
+ void cleanup();
+
+public:
+ Sample_SoloMeshSimple();
+ virtual ~Sample_SoloMeshSimple();
+
+ virtual void handleSettings();
+ virtual void handleTools();
+ virtual void handleDebugMode();
+
+ virtual void handleRender();
+ virtual void handleRenderOverlay(double* proj, double* model, int* view);
+ virtual void handleMeshChanged(class InputGeom* geom);
+ virtual bool handleBuild();
+};
+
+
+#endif // RECASTSAMPLESOLOMESHSIMPLE_H
diff --git a/dep/recastnavigation/RecastDemo/Include/Sample_SoloMeshTiled.h b/dep/recastnavigation/RecastDemo/Include/Sample_SoloMeshTiled.h
new file mode 100644
index 000000000..95d4f0a38
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/Sample_SoloMeshTiled.h
@@ -0,0 +1,124 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef RECASTSAMPLESOLOMESHTILED_H
+#define RECASTSAMPLESOLOMESHTILED_H
+
+#include "Sample.h"
+#include "DetourNavMesh.h"
+#include "Recast.h"
+#include "ChunkyTriMesh.h"
+
+class Sample_SoloMeshTiled : public Sample
+{
+protected:
+ struct Tile
+ {
+ inline Tile() : chf(0), solid(0), cset(0), pmesh(0), dmesh(0), buildTime(0) {}
+ inline ~Tile()
+ {
+ rcFreeCompactHeightfield(chf);
+ rcFreeContourSet(cset);
+ rcFreeHeightField(solid);
+ rcFreePolyMesh(pmesh);
+ rcFreePolyMeshDetail(dmesh);
+ }
+ int x, y;
+ rcCompactHeightfield* chf;
+ rcHeightfield* solid;
+ rcContourSet* cset;
+ rcPolyMesh* pmesh;
+ rcPolyMeshDetail* dmesh;
+ int buildTime;
+ };
+
+ struct TileSet
+ {
+ inline TileSet() : width(0), height(0), tiles(0) {}
+ inline ~TileSet() { delete [] tiles; }
+ int width, height;
+ float bmin[3], bmax[3];
+ float cs, ch;
+ Tile* tiles;
+ };
+
+ bool m_measurePerTileTimings;
+ bool m_keepInterResults;
+ float m_tileSize;
+ float m_totalBuildTimeMs;
+
+ rcPolyMesh* m_pmesh;
+ rcPolyMeshDetail* m_dmesh;
+ rcConfig m_cfg;
+ TileSet* m_tileSet;
+
+ static const int MAX_STAT_BUCKETS = 1000;
+ int m_statPolysPerTile[MAX_STAT_BUCKETS];
+ int m_statPolysPerTileSamples;
+ int m_statTimePerTile[MAX_STAT_BUCKETS];
+ int m_statTimePerTileSamples;
+
+ int m_highLightedTileX, m_highLightedTileY;
+
+ enum DrawMode
+ {
+ DRAWMODE_NAVMESH,
+ DRAWMODE_NAVMESH_TRANS,
+ DRAWMODE_NAVMESH_BVTREE,
+ DRAWMODE_NAVMESH_NODES,
+ DRAWMODE_NAVMESH_INVIS,
+ DRAWMODE_MESH,
+ DRAWMODE_VOXELS,
+ DRAWMODE_VOXELS_WALKABLE,
+ DRAWMODE_COMPACT,
+ DRAWMODE_COMPACT_DISTANCE,
+ DRAWMODE_COMPACT_REGIONS,
+ DRAWMODE_REGION_CONNECTIONS,
+ DRAWMODE_RAW_CONTOURS,
+ DRAWMODE_BOTH_CONTOURS,
+ DRAWMODE_CONTOURS,
+ DRAWMODE_POLYMESH,
+ DRAWMODE_POLYMESH_DETAIL,
+ MAX_DRAWMODE
+ };
+
+ DrawMode m_drawMode;
+
+ void cleanup();
+ bool canDrawTile(int x, int y);
+
+public:
+ Sample_SoloMeshTiled();
+ virtual ~Sample_SoloMeshTiled();
+
+ virtual void handleSettings();
+ virtual void handleTools();
+ virtual void handleDebugMode();
+
+ virtual void handleRender();
+ virtual void handleRenderOverlay(double* proj, double* model, int* view);
+ virtual void handleMeshChanged(class InputGeom* geom);
+ virtual bool handleBuild();
+
+ void setHighlightedTile(const float* pos);
+ inline int getHilightedTileX() const { return m_highLightedTileX; }
+ inline int getHilightedTileY() const { return m_highLightedTileY; }
+};
+
+
+#endif // RECASTSAMPLESOLOMESHTILED_H
diff --git a/dep/recastnavigation/RecastDemo/Include/Sample_TileMesh.h b/dep/recastnavigation/RecastDemo/Include/Sample_TileMesh.h
new file mode 100644
index 000000000..c010d2a27
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/Sample_TileMesh.h
@@ -0,0 +1,107 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef RECASTSAMPLETILEMESH_H
+#define RECASTSAMPLETILEMESH_H
+
+#include "Sample.h"
+#include "DetourNavMesh.h"
+#include "Recast.h"
+#include "ChunkyTriMesh.h"
+
+class Sample_TileMesh : public Sample
+{
+protected:
+ bool m_keepInterResults;
+ bool m_buildAll;
+ float m_totalBuildTimeMs;
+ bool m_drawPortals;
+
+ unsigned char* m_triareas;
+ rcHeightfield* m_solid;
+ rcCompactHeightfield* m_chf;
+ rcContourSet* m_cset;
+ rcPolyMesh* m_pmesh;
+ rcPolyMeshDetail* m_dmesh;
+ rcConfig m_cfg;
+
+ enum DrawMode
+ {
+ DRAWMODE_NAVMESH,
+ DRAWMODE_NAVMESH_TRANS,
+ DRAWMODE_NAVMESH_BVTREE,
+ DRAWMODE_NAVMESH_NODES,
+ DRAWMODE_NAVMESH_PORTALS,
+ DRAWMODE_NAVMESH_INVIS,
+ DRAWMODE_MESH,
+ DRAWMODE_VOXELS,
+ DRAWMODE_VOXELS_WALKABLE,
+ DRAWMODE_COMPACT,
+ DRAWMODE_COMPACT_DISTANCE,
+ DRAWMODE_COMPACT_REGIONS,
+ DRAWMODE_REGION_CONNECTIONS,
+ DRAWMODE_RAW_CONTOURS,
+ DRAWMODE_BOTH_CONTOURS,
+ DRAWMODE_CONTOURS,
+ DRAWMODE_POLYMESH,
+ DRAWMODE_POLYMESH_DETAIL,
+ MAX_DRAWMODE
+ };
+
+ DrawMode m_drawMode;
+
+ int m_maxTiles;
+ int m_maxPolysPerTile;
+ float m_tileSize;
+
+ unsigned int m_tileCol;
+ float m_tileBmin[3];
+ float m_tileBmax[3];
+ float m_tileBuildTime;
+ float m_tileMemUsage;
+ int m_tileTriCount;
+
+ unsigned char* buildTileMesh(const int tx, const int ty, const float* bmin, const float* bmax, int& dataSize);
+
+ void cleanup();
+
+ void saveAll(const char* path, const dtNavMesh* mesh);
+ dtNavMesh* loadAll(const char* path);
+
+public:
+ Sample_TileMesh();
+ virtual ~Sample_TileMesh();
+
+ virtual void handleSettings();
+ virtual void handleTools();
+ virtual void handleDebugMode();
+ virtual void handleRender();
+ virtual void handleRenderOverlay(double* proj, double* model, int* view);
+ virtual void handleMeshChanged(class InputGeom* geom);
+ virtual bool handleBuild();
+
+ void getTilePos(const float* pos, int& tx, int& ty);
+
+ void buildTile(const float* pos);
+ void removeTile(const float* pos);
+ void buildAllTiles();
+ void removeAllTiles();
+};
+
+
+#endif // RECASTSAMPLETILEMESH_H
diff --git a/dep/recastnavigation/RecastDemo/Include/SlideShow.h b/dep/recastnavigation/RecastDemo/Include/SlideShow.h
new file mode 100644
index 000000000..c2f5d16d6
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/SlideShow.h
@@ -0,0 +1,53 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef SLIDESHOW_H
+#define SLIDESHOW_H
+
+#include "Filelist.h"
+
+class SlideShow
+{
+ FileList m_files;
+ char m_path[256];
+
+ int m_width;
+ int m_height;
+ unsigned int m_texId;
+
+ void purgeImage();
+ bool loadImage(const char* path);
+
+ bool m_showSlides;
+ bool m_showCurSlide;
+ float m_slideAlpha;
+ int m_curSlide;
+ int m_nextSlide;
+
+public:
+ SlideShow();
+ ~SlideShow();
+
+ bool init(const char* path);
+ void nextSlide();
+ void prevSlide();
+ void setSlide(int n);
+ void updateAndDraw(float dt, const float w, const float h);
+};
+
+#endif // SLIDESHOW_H
diff --git a/dep/recastnavigation/RecastDemo/Include/TestCase.h b/dep/recastnavigation/RecastDemo/Include/TestCase.h
new file mode 100644
index 000000000..19d1b915e
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/TestCase.h
@@ -0,0 +1,79 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef TESTCASE_H
+#define TESTCASE_H
+
+#include "DetourNavMesh.h"
+
+class TestCase
+{
+ enum TestType
+ {
+ TEST_PATHFIND,
+ };
+
+ struct Test
+ {
+ Test() : straight(0), nstraight(0), polys(0), npolys(0) {};
+ ~Test()
+ {
+ delete [] straight;
+ delete [] polys;
+ }
+
+ TestType type;
+ float spos[3], epos[3];
+ float radius;
+ int includeFlags, excludeFlags;
+ bool expand;
+
+ float* straight;
+ int nstraight;
+ dtPolyRef* polys;
+ int npolys;
+
+ int findNearestPolyTime;
+ int findPathTime;
+ int findStraightPathTime;
+
+ Test* next;
+ };
+
+ char m_sampleName[256];
+ char m_geomFileName[256];
+ Test* m_tests;
+
+ void resetTimes();
+
+public:
+ TestCase();
+ ~TestCase();
+
+ bool load(const char* filePath);
+
+ inline const char* getSampleName() const { return m_sampleName; }
+ inline const char* getGeomFileName() const { return m_geomFileName; }
+
+ void doTests(class dtNavMesh* navmesh, class dtNavMeshQuery* navquery);
+
+ void handleRender();
+ bool handleRenderOverlay(double* proj, double* model, int* view);
+};
+
+#endif // TESTCASE_H
\ No newline at end of file
diff --git a/dep/recastnavigation/RecastDemo/Include/ValueHistory.h b/dep/recastnavigation/RecastDemo/Include/ValueHistory.h
new file mode 100644
index 000000000..4a37ed9c2
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/ValueHistory.h
@@ -0,0 +1,51 @@
+#ifndef VALUEHISTORY_H
+#define VALUEHISTORY_H
+
+class ValueHistory
+{
+ static const int MAX_HISTORY = 256;
+ float m_samples[MAX_HISTORY];
+ int m_hsamples;
+public:
+ ValueHistory();
+ ~ValueHistory();
+
+ inline void addSample(const float val)
+ {
+ m_hsamples = (m_hsamples+MAX_HISTORY-1) % MAX_HISTORY;
+ m_samples[m_hsamples] = val;
+ }
+
+ inline int getSampleCount() const
+ {
+ return MAX_HISTORY;
+ }
+
+ inline float getSample(const int i) const
+ {
+ return m_samples[(m_hsamples+i) % MAX_HISTORY];
+ }
+
+ float getSampleMin() const;
+ float getSampleMax() const;
+ float getAverage() const;
+};
+
+struct GraphParams
+{
+ void setRect(int ix, int iy, int iw, int ih, int ipad);
+ void setValueRange(float ivmin, float ivmax, int indiv, const char* iunits);
+
+ int x, y, w, h, pad;
+ float vmin, vmax;
+ int ndiv;
+ char units[16];
+};
+
+void drawGraphBackground(const GraphParams* p);
+
+void drawGraph(const GraphParams* p, const ValueHistory* graph,
+ int idx, const char* label, const unsigned int col);
+
+
+#endif // VALUEHISTORY_H
\ No newline at end of file
diff --git a/dep/recastnavigation/RecastDemo/Include/imgui.h b/dep/recastnavigation/RecastDemo/Include/imgui.h
new file mode 100644
index 000000000..325829b3d
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/imgui.h
@@ -0,0 +1,108 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef IMGUI_H
+#define IMGUI_H
+
+enum imguiMouseButton
+{
+ IMGUI_MBUT_LEFT = 0x01,
+ IMGUI_MBUT_RIGHT = 0x02,
+};
+
+enum imguiTextAlign
+{
+ IMGUI_ALIGN_LEFT,
+ IMGUI_ALIGN_CENTER,
+ IMGUI_ALIGN_RIGHT,
+};
+
+inline unsigned int imguiRGBA(unsigned char r, unsigned char g, unsigned char b, unsigned char a=255)
+{
+ return (r) | (g << 8) | (b << 16) | (a << 24);
+}
+
+void imguiBeginFrame(int mx, int my, unsigned char mbut, int scroll);
+void imguiEndFrame();
+
+bool imguiBeginScrollArea(const char* name, int x, int y, int w, int h, int* scroll);
+void imguiEndScrollArea();
+
+void imguiIndent();
+void imguiUnindent();
+void imguiSeparator();
+void imguiSeparatorLine();
+
+bool imguiButton(const char* text, bool enabled = true);
+bool imguiItem(const char* text, bool enabled = true);
+bool imguiCheck(const char* text, bool checked, bool enabled = true);
+bool imguiCollapse(const char* text, const char* subtext, bool checked, bool enabled = true);
+void imguiLabel(const char* text);
+void imguiValue(const char* text);
+bool imguiSlider(const char* text, float* val, float vmin, float vmax, float vinc, bool enabled = true);
+
+void imguiDrawText(int x, int y, int align, const char* text, unsigned int color);
+void imguiDrawLine(float x0, float y0, float x1, float y1, float r, unsigned int color);
+void imguiDrawRoundedRect(float x, float y, float w, float h, float r, unsigned int color);
+void imguiDrawRect(float x, float y, float w, float h, unsigned int color);
+
+// Pull render interface.
+enum imguiGfxCmdType
+{
+ IMGUI_GFXCMD_RECT,
+ IMGUI_GFXCMD_TRIANGLE,
+ IMGUI_GFXCMD_LINE,
+ IMGUI_GFXCMD_TEXT,
+ IMGUI_GFXCMD_SCISSOR,
+};
+
+struct imguiGfxRect
+{
+ short x,y,w,h,r;
+};
+
+struct imguiGfxText
+{
+ short x,y,align;
+ const char* text;
+};
+
+struct imguiGfxLine
+{
+ short x0,y0,x1,y1,r;
+};
+
+struct imguiGfxCmd
+{
+ char type;
+ char flags;
+ char pad[2];
+ unsigned int col;
+ union
+ {
+ imguiGfxLine line;
+ imguiGfxRect rect;
+ imguiGfxText text;
+ };
+};
+
+const imguiGfxCmd* imguiGetRenderQueue();
+int imguiGetRenderQueueSize();
+
+
+#endif // IMGUI_H
diff --git a/dep/recastnavigation/RecastDemo/Include/imguiRenderGL.h b/dep/recastnavigation/RecastDemo/Include/imguiRenderGL.h
new file mode 100644
index 000000000..b14834169
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Include/imguiRenderGL.h
@@ -0,0 +1,26 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#ifndef IMGUI_RENDER_GL_H
+#define IMGUI_RENDER_GL_H
+
+bool imguiRenderGLInit(const char* fontpath);
+void imguiRenderGLDestroy();
+void imguiRenderGLDraw();
+
+#endif // IMGUI_RENDER_GL_H
\ No newline at end of file
diff --git a/dep/recastnavigation/RecastDemo/Source/ChunkyTriMesh.cpp b/dep/recastnavigation/RecastDemo/Source/ChunkyTriMesh.cpp
new file mode 100644
index 000000000..47e877875
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/ChunkyTriMesh.cpp
@@ -0,0 +1,315 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#include "ChunkyTriMesh.h"
+#include
+#include
+#include
+
+struct BoundsItem
+{
+ float bmin[2];
+ float bmax[2];
+ int i;
+};
+
+static int compareItemX(const void* va, const void* vb)
+{
+ const BoundsItem* a = (const BoundsItem*)va;
+ const BoundsItem* b = (const BoundsItem*)vb;
+ if (a->bmin[0] < b->bmin[0])
+ return -1;
+ if (a->bmin[0] > b->bmin[0])
+ return 1;
+ return 0;
+}
+
+static int compareItemY(const void* va, const void* vb)
+{
+ const BoundsItem* a = (const BoundsItem*)va;
+ const BoundsItem* b = (const BoundsItem*)vb;
+ if (a->bmin[1] < b->bmin[1])
+ return -1;
+ if (a->bmin[1] > b->bmin[1])
+ return 1;
+ return 0;
+}
+
+static void calcExtends(const BoundsItem* items, const int /*nitems*/,
+ const int imin, const int imax,
+ float* bmin, float* bmax)
+{
+ bmin[0] = items[imin].bmin[0];
+ bmin[1] = items[imin].bmin[1];
+
+ bmax[0] = items[imin].bmax[0];
+ bmax[1] = items[imin].bmax[1];
+
+ for (int i = imin+1; i < imax; ++i)
+ {
+ const BoundsItem& it = items[i];
+ if (it.bmin[0] < bmin[0]) bmin[0] = it.bmin[0];
+ if (it.bmin[1] < bmin[1]) bmin[1] = it.bmin[1];
+
+ if (it.bmax[0] > bmax[0]) bmax[0] = it.bmax[0];
+ if (it.bmax[1] > bmax[1]) bmax[1] = it.bmax[1];
+ }
+}
+
+inline int longestAxis(float x, float y)
+{
+ return y > x ? 1 : 0;
+}
+
+static void subdivide(BoundsItem* items, int nitems, int imin, int imax, int trisPerChunk,
+ int& curNode, rcChunkyTriMeshNode* nodes, const int maxNodes,
+ int& curTri, int* outTris, const int* inTris)
+{
+ int inum = imax - imin;
+ int icur = curNode;
+
+ if (curNode > maxNodes)
+ return;
+
+ rcChunkyTriMeshNode& node = nodes[curNode++];
+
+ if (inum <= trisPerChunk)
+ {
+ // Leaf
+ calcExtends(items, nitems, imin, imax, node.bmin, node.bmax);
+
+ // Copy triangles.
+ node.i = curTri;
+ node.n = inum;
+
+ for (int i = imin; i < imax; ++i)
+ {
+ const int* src = &inTris[items[i].i*3];
+ int* dst = &outTris[curTri*3];
+ curTri++;
+ dst[0] = src[0];
+ dst[1] = src[1];
+ dst[2] = src[2];
+ }
+ }
+ else
+ {
+ // Split
+ calcExtends(items, nitems, imin, imax, node.bmin, node.bmax);
+
+ int axis = longestAxis(node.bmax[0] - node.bmin[0],
+ node.bmax[1] - node.bmin[1]);
+
+ if (axis == 0)
+ {
+ // Sort along x-axis
+ qsort(items+imin, inum, sizeof(BoundsItem), compareItemX);
+ }
+ else if (axis == 1)
+ {
+ // Sort along y-axis
+ qsort(items+imin, inum, sizeof(BoundsItem), compareItemY);
+ }
+
+ int isplit = imin+inum/2;
+
+ // Left
+ subdivide(items, nitems, imin, isplit, trisPerChunk, curNode, nodes, maxNodes, curTri, outTris, inTris);
+ // Right
+ subdivide(items, nitems, isplit, imax, trisPerChunk, curNode, nodes, maxNodes, curTri, outTris, inTris);
+
+ int iescape = curNode - icur;
+ // Negative index means escape.
+ node.i = -iescape;
+ }
+}
+
+bool rcCreateChunkyTriMesh(const float* verts, const int* tris, int ntris,
+ int trisPerChunk, rcChunkyTriMesh* cm)
+{
+ int nchunks = (ntris + trisPerChunk-1) / trisPerChunk;
+
+ cm->nodes = new rcChunkyTriMeshNode[nchunks*4];
+ if (!cm->nodes)
+ return false;
+
+ cm->tris = new int[ntris*3];
+ if (!cm->tris)
+ return false;
+
+ cm->ntris = ntris;
+
+ // Build tree
+ BoundsItem* items = new BoundsItem[ntris];
+ if (!items)
+ return false;
+
+ for (int i = 0; i < ntris; i++)
+ {
+ const int* t = &tris[i*3];
+ BoundsItem& it = items[i];
+ it.i = i;
+ // Calc triangle XZ bounds.
+ it.bmin[0] = it.bmax[0] = verts[t[0]*3+0];
+ it.bmin[1] = it.bmax[1] = verts[t[0]*3+2];
+ for (int j = 1; j < 3; ++j)
+ {
+ const float* v = &verts[t[j]*3];
+ if (v[0] < it.bmin[0]) it.bmin[0] = v[0];
+ if (v[2] < it.bmin[1]) it.bmin[1] = v[2];
+
+ if (v[0] > it.bmax[0]) it.bmax[0] = v[0];
+ if (v[2] > it.bmax[1]) it.bmax[1] = v[2];
+ }
+ }
+
+ int curTri = 0;
+ int curNode = 0;
+ subdivide(items, ntris, 0, ntris, trisPerChunk, curNode, cm->nodes, nchunks*4, curTri, cm->tris, tris);
+
+ delete [] items;
+
+ cm->nnodes = curNode;
+
+ // Calc max tris per node.
+ cm->maxTrisPerChunk = 0;
+ for (int i = 0; i < cm->nnodes; ++i)
+ {
+ rcChunkyTriMeshNode& node = cm->nodes[i];
+ const bool isLeaf = node.i >= 0;
+ if (!isLeaf) continue;
+ if (node.n > cm->maxTrisPerChunk)
+ cm->maxTrisPerChunk = node.n;
+ }
+
+ return true;
+}
+
+
+inline bool checkOverlapRect(const float amin[2], const float amax[2],
+ const float bmin[2], const float bmax[2])
+{
+ bool overlap = true;
+ overlap = (amin[0] > bmax[0] || amax[0] < bmin[0]) ? false : overlap;
+ overlap = (amin[1] > bmax[1] || amax[1] < bmin[1]) ? false : overlap;
+ return overlap;
+}
+
+int rcGetChunksOverlappingRect(const rcChunkyTriMesh* cm,
+ float bmin[2], float bmax[2],
+ int* ids, const int maxIds)
+{
+ // Traverse tree
+ int i = 0;
+ int n = 0;
+ while (i < cm->nnodes)
+ {
+ const rcChunkyTriMeshNode* node = &cm->nodes[i];
+ const bool overlap = checkOverlapRect(bmin, bmax, node->bmin, node->bmax);
+ const bool isLeafNode = node->i >= 0;
+
+ if (isLeafNode && overlap)
+ {
+ if (n < maxIds)
+ {
+ ids[n] = i;
+ n++;
+ }
+ }
+
+ if (overlap || isLeafNode)
+ i++;
+ else
+ {
+ const int escapeIndex = -node->i;
+ i += escapeIndex;
+ }
+ }
+
+ return n;
+}
+
+
+
+static bool checkOverlapSegment(const float p[2], const float q[2],
+ const float bmin[2], const float bmax[2])
+{
+ static const float EPSILON = 1e-6f;
+
+ float tmin = 0;
+ float tmax = 1;
+ float d[2];
+ d[0] = q[0] - p[0];
+ d[1] = q[1] - p[1];
+
+ for (int i = 0; i < 2; i++)
+ {
+ if (fabsf(d[i]) < EPSILON)
+ {
+ // Ray is parallel to slab. No hit if origin not within slab
+ if (p[i] < bmin[i] || p[i] > bmax[i])
+ return false;
+ }
+ else
+ {
+ // Compute intersection t value of ray with near and far plane of slab
+ float ood = 1.0f / d[i];
+ float t1 = (bmin[i] - p[i]) * ood;
+ float t2 = (bmax[i] - p[i]) * ood;
+ if (t1 > t2) { float tmp = t1; t1 = t2; t2 = tmp; }
+ if (t1 > tmin) tmin = t1;
+ if (t2 < tmax) tmax = t2;
+ if (tmin > tmax) return false;
+ }
+ }
+ return true;
+}
+
+int rcGetChunksOverlappingSegment(const rcChunkyTriMesh* cm,
+ float p[2], float q[2],
+ int* ids, const int maxIds)
+{
+ // Traverse tree
+ int i = 0;
+ int n = 0;
+ while (i < cm->nnodes)
+ {
+ const rcChunkyTriMeshNode* node = &cm->nodes[i];
+ const bool overlap = checkOverlapSegment(p, q, node->bmin, node->bmax);
+ const bool isLeafNode = node->i >= 0;
+
+ if (isLeafNode && overlap)
+ {
+ if (n < maxIds)
+ {
+ ids[n] = i;
+ n++;
+ }
+ }
+
+ if (overlap || isLeafNode)
+ i++;
+ else
+ {
+ const int escapeIndex = -node->i;
+ i += escapeIndex;
+ }
+ }
+
+ return n;
+}
diff --git a/dep/recastnavigation/RecastDemo/Source/ConvexVolumeTool.cpp b/dep/recastnavigation/RecastDemo/Source/ConvexVolumeTool.cpp
new file mode 100644
index 000000000..00c9e0997
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/ConvexVolumeTool.cpp
@@ -0,0 +1,283 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#define _USE_MATH_DEFINES
+#include
+#include
+#include
+#include
+#include "SDL.h"
+#include "SDL_opengl.h"
+#include "imgui.h"
+#include "ConvexVolumeTool.h"
+#include "InputGeom.h"
+#include "Sample.h"
+#include "Recast.h"
+#include "RecastDebugDraw.h"
+#include "DetourDebugDraw.h"
+
+#ifdef WIN32
+# define snprintf _snprintf
+#endif
+
+// Quick and dirty convex hull.
+
+// Returns true if 'c' is left of line 'a'-'b'.
+inline bool left(const float* a, const float* b, const float* c)
+{
+ const float u1 = b[0] - a[0];
+ const float v1 = b[2] - a[2];
+ const float u2 = c[0] - a[0];
+ const float v2 = c[2] - a[2];
+ return u1 * v2 - v1 * u2 < 0;
+}
+
+// Returns true if 'a' is more lower-left than 'b'.
+inline bool cmppt(const float* a, const float* b)
+{
+ if (a[0] < b[0]) return true;
+ if (a[0] > b[0]) return false;
+ if (a[2] < b[2]) return true;
+ if (a[2] > b[2]) return false;
+ return false;
+}
+// Calculates convex hull on xz-plane of points on 'pts',
+// stores the indices of the resulting hull in 'out' and
+// returns number of points on hull.
+static int convexhull(const float* pts, int npts, int* out)
+{
+ // Find lower-leftmost point.
+ int hull = 0;
+ for (int i = 1; i < npts; ++i)
+ if (cmppt(&pts[i*3], &pts[hull*3]))
+ hull = i;
+ // Gift wrap hull.
+ int endpt = 0;
+ int i = 0;
+ do
+ {
+ out[i++] = hull;
+ endpt = 0;
+ for (int j = 1; j < npts; ++j)
+ if (hull == endpt || left(&pts[hull*3], &pts[endpt*3], &pts[j*3]))
+ endpt = j;
+ hull = endpt;
+ }
+ while (endpt != out[0]);
+
+ return i;
+}
+
+static int pointInPoly(int nvert, const float* verts, const float* p)
+{
+ int i, j, c = 0;
+ for (i = 0, j = nvert-1; i < nvert; j = i++)
+ {
+ const float* vi = &verts[i*3];
+ const float* vj = &verts[j*3];
+ if (((vi[2] > p[2]) != (vj[2] > p[2])) &&
+ (p[0] < (vj[0]-vi[0]) * (p[2]-vi[2]) / (vj[2]-vi[2]) + vi[0]) )
+ c = !c;
+ }
+ return c;
+}
+
+
+ConvexVolumeTool::ConvexVolumeTool() :
+ m_sample(0),
+ m_areaType(SAMPLE_POLYAREA_GRASS),
+ m_boxHeight(6.0f),
+ m_boxDescent(1.0f),
+ m_npts(0),
+ m_nhull(0)
+{
+}
+
+ConvexVolumeTool::~ConvexVolumeTool()
+{
+}
+
+void ConvexVolumeTool::init(Sample* sample)
+{
+ m_sample = sample;
+}
+
+void ConvexVolumeTool::reset()
+{
+ m_npts = 0;
+ m_nhull = 0;
+}
+
+void ConvexVolumeTool::handleMenu()
+{
+ imguiSlider("Shape Height", &m_boxHeight, 0.1f, 20.0f, 0.1f);
+ imguiSlider("Shape Descent", &m_boxDescent, 0.1f, 20.0f, 0.1f);
+
+ imguiSeparator();
+
+ imguiLabel("Area Type");
+ imguiIndent();
+ if (imguiCheck("Grass", m_areaType == SAMPLE_POLYAREA_GRASS))
+ m_areaType = SAMPLE_POLYAREA_GRASS;
+ if (imguiCheck("Road", m_areaType == SAMPLE_POLYAREA_ROAD))
+ m_areaType = SAMPLE_POLYAREA_ROAD;
+ if (imguiCheck("Water", m_areaType == SAMPLE_POLYAREA_WATER))
+ m_areaType = SAMPLE_POLYAREA_WATER;
+ if (imguiCheck("Door", m_areaType == SAMPLE_POLYAREA_DOOR))
+ m_areaType = SAMPLE_POLYAREA_DOOR;
+ imguiUnindent();
+
+ imguiSeparator();
+
+ if (imguiButton("Clear Shape"))
+ {
+ m_npts = 0;
+ m_nhull = 0;
+ }
+
+ imguiSeparator();
+
+ imguiValue("Click to create points.");
+ imguiValue("The shape is convex hull");
+ imguiValue("of all the create points.");
+ imguiValue("Click on highlited point");
+ imguiValue("to finish the shape.");
+
+ imguiSeparator();
+}
+
+void ConvexVolumeTool::handleClick(const float* /*s*/, const float* p, bool shift)
+{
+ if (!m_sample) return;
+ InputGeom* geom = m_sample->getInputGeom();
+ if (!geom) return;
+
+ if (shift)
+ {
+ // Delete
+ int nearestIndex = -1;
+ const ConvexVolume* vols = geom->getConvexVolumes();
+ for (int i = 0; i < geom->getConvexVolumeCount(); ++i)
+ {
+ if (pointInPoly(vols[i].nverts, vols[i].verts, p) &&
+ p[1] >= vols[i].hmin && p[1] <= vols[i].hmax)
+ {
+ nearestIndex = i;
+ }
+ }
+ // If end point close enough, delete it.
+ if (nearestIndex != -1)
+ {
+ geom->deleteConvexVolume(nearestIndex);
+ }
+ }
+ else
+ {
+ // Create
+
+ // If clicked on that last pt, create the shape.
+ if (m_npts && rcVdistSqr(p, &m_pts[(m_npts-1)*3]) < rcSqr(0.2f))
+ {
+ if (m_nhull > 2)
+ {
+ // Create shape.
+ float verts[MAX_PTS*3];
+ for (int i = 0; i < m_nhull; ++i)
+ rcVcopy(&verts[i*3], &m_pts[m_hull[i]*3]);
+
+ float minh = FLT_MAX, maxh = 0;
+ for (int i = 0; i < m_nhull; ++i)
+ minh = rcMin(minh, verts[i*3+1]);
+ minh -= m_boxDescent;
+ maxh = minh + m_boxHeight;
+
+ geom->addConvexVolume(verts, m_nhull, minh, maxh, (unsigned char)m_areaType);
+ }
+
+ m_npts = 0;
+ m_nhull = 0;
+ }
+ else
+ {
+ // Add new point
+ if (m_npts < MAX_PTS)
+ {
+ rcVcopy(&m_pts[m_npts*3], p);
+ m_npts++;
+ // Update hull.
+ if (m_npts > 1)
+ m_nhull = convexhull(m_pts, m_npts, m_hull);
+ else
+ m_nhull = 0;
+ }
+ }
+ }
+
+}
+
+void ConvexVolumeTool::handleToggle()
+{
+}
+
+void ConvexVolumeTool::handleStep()
+{
+}
+
+void ConvexVolumeTool::handleUpdate(const float /*dt*/)
+{
+}
+
+void ConvexVolumeTool::handleRender()
+{
+ DebugDrawGL dd;
+
+ // Find height extents of the shape.
+ float minh = FLT_MAX, maxh = 0;
+ for (int i = 0; i < m_npts; ++i)
+ minh = rcMin(minh, m_pts[i*3+1]);
+ minh -= m_boxDescent;
+ maxh = minh + m_boxHeight;
+
+ dd.begin(DU_DRAW_POINTS, 4.0f);
+ for (int i = 0; i < m_npts; ++i)
+ {
+ unsigned int col = duRGBA(255,255,255,255);
+ if (i == m_npts-1)
+ col = duRGBA(240,32,16,255);
+ dd.vertex(m_pts[i*3+0],m_pts[i*3+1]+0.1f,m_pts[i*3+2], col);
+ }
+ dd.end();
+
+ dd.begin(DU_DRAW_LINES, 2.0f);
+ for (int i = 0, j = m_nhull-1; i < m_nhull; j = i++)
+ {
+ const float* vi = &m_pts[m_hull[j]*3];
+ const float* vj = &m_pts[m_hull[i]*3];
+ dd.vertex(vj[0],minh,vj[2], duRGBA(255,255,255,64));
+ dd.vertex(vi[0],minh,vi[2], duRGBA(255,255,255,64));
+ dd.vertex(vj[0],maxh,vj[2], duRGBA(255,255,255,64));
+ dd.vertex(vi[0],maxh,vi[2], duRGBA(255,255,255,64));
+ dd.vertex(vj[0],minh,vj[2], duRGBA(255,255,255,64));
+ dd.vertex(vj[0],maxh,vj[2], duRGBA(255,255,255,64));
+ }
+ dd.end();
+}
+
+void ConvexVolumeTool::handleRenderOverlay(double* /*proj*/, double* /*model*/, int* /*view*/)
+{
+}
diff --git a/dep/recastnavigation/RecastDemo/Source/CrowdManager.cpp b/dep/recastnavigation/RecastDemo/Source/CrowdManager.cpp
new file mode 100644
index 000000000..9211d675c
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/CrowdManager.cpp
@@ -0,0 +1,1593 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#define _USE_MATH_DEFINES
+#include
+#include
+#include
+#include
+#include
+#include "DetourNavMesh.h"
+#include "DetourNavMeshQuery.h"
+#include "DetourObstacleAvoidance.h"
+#include "DetourCommon.h"
+#include "CrowdManager.h"
+#include "SampleInterfaces.h" // For timer
+#include "DetourAssert.h"
+#include "DetourAlloc.h"
+
+static const int VO_ADAPTIVE_DIVS = 7;
+static const int VO_ADAPTIVE_RINGS = 2;
+static const int VO_ADAPTIVE_DEPTH = 5;
+
+static const int VO_GRID_SIZE = 33;
+
+
+inline int hashPos2(int x, int y, int n)
+{
+ return ((x*73856093) ^ (y*19349663)) & (n-1);
+}
+
+ProximityGrid::ProximityGrid() :
+ m_maxItems(0),
+ m_cellSize(0),
+ m_pool(0),
+ m_poolHead(0),
+ m_poolSize(0),
+ m_buckets(0),
+ m_bucketsSize(0)
+{
+}
+
+ProximityGrid::~ProximityGrid()
+{
+ dtFree(m_buckets);
+ dtFree(m_pool);
+}
+
+bool ProximityGrid::init(const int maxItems, const float cellSize)
+{
+ dtAssert(maxItems > 0);
+ dtAssert(cellSize > 0.0f);
+
+ m_cellSize = cellSize;
+ m_invCellSize = 1.0f / m_cellSize;
+
+ // Allocate hashs buckets
+ m_bucketsSize = dtNextPow2(maxItems);
+ m_buckets = (unsigned short*)dtAlloc(sizeof(unsigned short)*m_bucketsSize, DT_ALLOC_PERM);
+ if (!m_buckets)
+ return false;
+
+ // Allocate pool of items.
+ m_poolSize = maxItems*4;
+ m_poolHead = 0;
+ m_pool = (Item*)dtAlloc(sizeof(Item)*m_poolSize, DT_ALLOC_PERM);
+ if (!m_pool)
+ return false;
+
+ clear();
+
+ return true;
+}
+
+void ProximityGrid::clear()
+{
+ memset(m_buckets, 0xff, sizeof(unsigned short)*m_bucketsSize);
+ m_poolHead = 0;
+ m_bounds[0] = 0xffff;
+ m_bounds[1] = 0xffff;
+ m_bounds[2] = -0xffff;
+ m_bounds[3] = -0xffff;
+}
+
+void ProximityGrid::addItem(const unsigned short id,
+ const float minx, const float miny,
+ const float maxx, const float maxy)
+{
+ const int iminx = (int)floorf(minx * m_invCellSize);
+ const int iminy = (int)floorf(miny * m_invCellSize);
+ const int imaxx = (int)floorf(maxx * m_invCellSize);
+ const int imaxy = (int)floorf(maxy * m_invCellSize);
+
+ m_bounds[0] = dtMin(m_bounds[0], iminx);
+ m_bounds[1] = dtMin(m_bounds[1], iminy);
+ m_bounds[2] = dtMax(m_bounds[2], imaxx);
+ m_bounds[3] = dtMax(m_bounds[3], imaxy);
+
+ for (int y = iminy; y <= imaxy; ++y)
+ {
+ for (int x = iminx; x <= imaxx; ++x)
+ {
+ if (m_poolHead < m_poolSize)
+ {
+ const int h = hashPos2(x, y, m_bucketsSize);
+ const unsigned short idx = (unsigned short)m_poolHead;
+ m_poolHead++;
+ Item& item = m_pool[idx];
+ item.x = (short)x;
+ item.y = (short)y;
+ item.id = id;
+ item.next = m_buckets[h];
+ m_buckets[h] = idx;
+ }
+ }
+ }
+}
+
+int ProximityGrid::queryItems(const float minx, const float miny,
+ const float maxx, const float maxy,
+ unsigned short* ids, const int maxIds) const
+{
+ const int iminx = (int)floorf(minx * m_invCellSize);
+ const int iminy = (int)floorf(miny * m_invCellSize);
+ const int imaxx = (int)floorf(maxx * m_invCellSize);
+ const int imaxy = (int)floorf(maxy * m_invCellSize);
+
+ int n = 0;
+
+ for (int y = iminy; y <= imaxy; ++y)
+ {
+ for (int x = iminx; x <= imaxx; ++x)
+ {
+ const int h = hashPos2(x, y, m_bucketsSize);
+ unsigned short idx = m_buckets[h];
+ while (idx != 0xffff)
+ {
+ Item& item = m_pool[idx];
+ if ((int)item.x == x && (int)item.y == y)
+ {
+ // Check if the id exists already.
+ const unsigned short* end = ids + n;
+ unsigned short* i = ids;
+ while (i != end && *i != item.id)
+ ++i;
+ // Item not found, add it.
+ if (i == end)
+ {
+ if (n >= maxIds)
+ return n;
+ ids[n++] = item.id;
+ }
+ }
+ idx = item.next;
+ }
+ }
+ }
+
+ return n;
+}
+
+int ProximityGrid::getItemCountAt(const int x, const int y) const
+{
+ int n = 0;
+
+ const int h = hashPos2(x, y, m_bucketsSize);
+ unsigned short idx = m_buckets[h];
+ while (idx != 0xffff)
+ {
+ Item& item = m_pool[idx];
+ if ((int)item.x == x && (int)item.y == y)
+ n++;
+ idx = item.next;
+ }
+
+ return n;
+}
+
+PathQueue::PathQueue() :
+ m_nextHandle(1),
+ m_delay(0)
+{
+ for (int i = 0; i < MAX_QUEUE; ++i)
+ m_queue[i].ref = PATHQ_INVALID;
+}
+
+PathQueue::~PathQueue()
+{
+}
+
+void PathQueue::update(dtNavMeshQuery* navquery)
+{
+ // Artificial delay to test the code better,
+ // update only one request too.
+
+ // TODO: Use sliced pathfinder.
+ m_delay++;
+ if ((m_delay % 4) == 0)
+ {
+ for (int i = 0; i < MAX_QUEUE; ++i)
+ {
+ PathQuery& q = m_queue[i];
+ if (q.ref == PATHQ_INVALID)
+ continue;
+ navquery->findPath(q.startRef, q.endRef, q.startPos, q.endPos,
+ q.filter, q.path, &q.npath, PQ_MAX_PATH);
+ q.ready = true;
+ break;
+ }
+ }
+
+ // Kill forgotten request.
+ for (int i = 0; i < MAX_QUEUE; ++i)
+ {
+ PathQuery& q = m_queue[i];
+ if (q.ref != PATHQ_INVALID && q.ready)
+ {
+ q.keepalive++;
+ if (q.keepalive > 2)
+ q.ref = PATHQ_INVALID;
+ }
+ }
+}
+
+PathQueueRef PathQueue::request(dtPolyRef startRef, dtPolyRef endRef,
+ const float* startPos, const float* endPos,
+ const dtQueryFilter* filter)
+{
+ // Find empty slot
+ int slot = -1;
+ for (int i = 0; i < MAX_QUEUE; ++i)
+ {
+ if (m_queue[i].ref == PATHQ_INVALID)
+ {
+ slot = i;
+ break;
+ }
+ }
+ // Could not find slot.
+ if (slot == -1)
+ return PATHQ_INVALID;
+
+ PathQueueRef ref = m_nextHandle++;
+ if (m_nextHandle == PATHQ_INVALID) m_nextHandle++;
+
+ PathQuery& q = m_queue[slot];
+ q.ref = ref;
+ dtVcopy(q.startPos, startPos);
+ q.startRef = startRef;
+ dtVcopy(q.endPos, endPos);
+ q.endRef = endRef;
+ q.ready = false;
+ q.npath = 0;
+ q.filter = filter; // TODO: This is potentially dangerous!
+ q.keepalive = 0;
+
+ return ref;
+}
+
+int PathQueue::getRequestState(PathQueueRef ref)
+{
+ for (int i = 0; i < MAX_QUEUE; ++i)
+ {
+ if (m_queue[i].ref == ref)
+ return m_queue[i].ready ? PATHQ_STATE_READY : PATHQ_STATE_WORKING;
+ }
+
+ return PATHQ_STATE_INVALID;
+}
+
+int PathQueue::getPathResult(PathQueueRef ref, dtPolyRef* path, const int maxPath)
+{
+ for (int i = 0; i < MAX_QUEUE; ++i)
+ {
+ if (m_queue[i].ref == ref)
+ {
+ PathQuery& q = m_queue[i];
+ // Allow to reuse the request.
+ q.ref = PATHQ_INVALID;
+ int n = 0;
+ for (int j = 0; j < q.npath && j < maxPath; ++j)
+ path[n++] = q.path[j];
+ return n;
+ }
+ }
+ return 0;
+}
+
+
+static int fixupCorridor(dtPolyRef* path, const int npath, const int maxPath,
+ const dtPolyRef* visited, const int nvisited)
+{
+ int furthestPath = -1;
+ int furthestVisited = -1;
+
+ // Find furthest common polygon.
+ for (int i = npath-1; i >= 0; --i)
+ {
+ bool found = false;
+ for (int j = nvisited-1; j >= 0; --j)
+ {
+ if (path[i] == visited[j])
+ {
+ furthestPath = i;
+ furthestVisited = j;
+ found = true;
+ }
+ }
+ if (found)
+ break;
+ }
+
+ // If no intersection found just return current path.
+ if (furthestPath == -1 || furthestVisited == -1)
+ return npath;
+
+ // Concatenate paths.
+
+ // Adjust beginning of the buffer to include the visited.
+ const int req = nvisited - furthestVisited;
+ const int orig = dtMin(furthestPath+1, npath);
+ int size = dtMax(0, npath-orig);
+ if (req+size > maxPath)
+ size = maxPath-req;
+ if (size)
+ memmove(path+req, path+orig, size*sizeof(dtPolyRef));
+
+ // Store visited
+ for (int i = 0; i < req; ++i)
+ path[i] = visited[(nvisited-1)-i];
+
+ return req+size;
+}
+
+static int fixupCorridorEnd(dtPolyRef* path, const int npath, const int maxPath,
+ const dtPolyRef* visited, const int nvisited)
+{
+ int furthestPath = -1;
+ int furthestVisited = -1;
+
+ // Find furthest common polygon.
+ for (int i = 0; i < npath; ++i)
+ {
+ bool found = false;
+ for (int j = nvisited-1; j >= 0; --j)
+ {
+ if (path[i] == visited[j])
+ {
+ furthestPath = i;
+ furthestVisited = j;
+ found = true;
+ }
+ }
+ if (found)
+ break;
+ }
+
+ // If no intersection found just return current path.
+ if (furthestPath == -1 || furthestVisited == -1)
+ return npath;
+
+ // Concatenate paths.
+ const int ppos = furthestPath+1;
+ const int vpos = furthestVisited+1;
+ const int count = dtMin(nvisited-vpos, maxPath-ppos);
+ dtAssert(ppos+count <= maxPath);
+ if (count)
+ memcpy(path+ppos, visited+vpos, sizeof(dtPolyRef)*count);
+
+ return ppos+count;
+}
+
+static int mergeCorridor(dtPolyRef* path, const int npath, const int maxPath,
+ const dtPolyRef* visited, const int nvisited)
+{
+ int furthestPath = -1;
+ int furthestVisited = -1;
+
+ // Find furthest common polygon.
+ for (int i = npath-1; i >= 0; --i)
+ {
+ bool found = false;
+ for (int j = nvisited-1; j >= 0; --j)
+ {
+ if (path[i] == visited[j])
+ {
+ furthestPath = i;
+ furthestVisited = j;
+ found = true;
+ }
+ }
+ if (found)
+ break;
+ }
+
+ // If no intersection found just return current path.
+ if (furthestPath == -1 || furthestVisited == -1)
+ return npath;
+
+ // Concatenate paths.
+
+ // Adjust beginning of the buffer to include the visited.
+ const int req = furthestVisited;
+ if (req <= 0)
+ return npath;
+
+ const int orig = furthestPath;
+ int size = dtMax(0, npath-orig);
+ if (req+size > maxPath)
+ size = maxPath-req;
+ if (size)
+ memmove(path+req, path+orig, size*sizeof(dtPolyRef));
+
+ // Store visited
+ for (int i = 0; i < req; ++i)
+ path[i] = visited[i];
+
+ return req+size;
+}
+
+PathCorridor::PathCorridor() :
+ m_path(0),
+ m_npath(0),
+ m_maxPath(0)
+{
+
+}
+
+PathCorridor::~PathCorridor()
+{
+ dtFree(m_path);
+}
+
+bool PathCorridor::init(const int maxPath)
+{
+ dtAssert(!m_path);
+ m_path = (dtPolyRef*)dtAlloc(sizeof(dtPolyRef)*maxPath, DT_ALLOC_PERM);
+ if (!m_path)
+ return false;
+ m_npath = 0;
+ m_maxPath = maxPath;
+ return true;
+}
+
+void PathCorridor::reset(dtPolyRef ref, const float* pos)
+{
+ dtAssert(m_path);
+ dtVcopy(m_pos, pos);
+ dtVcopy(m_target, pos);
+ m_path[0] = ref;
+ m_npath = 1;
+}
+
+int PathCorridor::findCorners(float* cornerVerts, unsigned char* cornerFlags,
+ dtPolyRef* cornerPolys, const int maxCorners,
+ dtNavMeshQuery* navquery, const dtQueryFilter* filter)
+{
+ dtAssert(m_path);
+ dtAssert(m_npath);
+
+ static const float MIN_TARGET_DIST = 0.01f;
+
+ int ncorners = 0;
+ navquery->findStraightPath(m_pos, m_target, m_path, m_npath,
+ cornerVerts, cornerFlags, cornerPolys, &ncorners, maxCorners);
+
+ // Prune points in the beginning of the path which are too close.
+ while (ncorners)
+ {
+ if ((cornerFlags[0] & DT_STRAIGHTPATH_OFFMESH_CONNECTION) ||
+ dtVdist2DSqr(&cornerVerts[0], m_pos) > dtSqr(MIN_TARGET_DIST))
+ break;
+ ncorners--;
+ if (ncorners)
+ {
+ memmove(cornerFlags, cornerFlags+1, sizeof(unsigned char)*ncorners);
+ memmove(cornerPolys, cornerPolys+1, sizeof(dtPolyRef)*ncorners);
+ memmove(cornerVerts, cornerVerts+3, sizeof(float)*3*ncorners);
+ }
+ }
+
+ // Prune points after an off-mesh connection.
+ for (int i = 0; i < ncorners; ++i)
+ {
+ if (cornerFlags[i] & DT_STRAIGHTPATH_OFFMESH_CONNECTION)
+ {
+ ncorners = i+1;
+ break;
+ }
+ }
+
+ return ncorners;
+}
+
+void PathCorridor::optimizePathVisibility(const float* next, const float pathOptimizationRange,
+ dtNavMeshQuery* navquery, const dtQueryFilter* filter)
+{
+ dtAssert(m_path);
+
+ // Clamp the ray to max distance.
+ float goal[3];
+ dtVcopy(goal, next);
+ float dist = dtVdist2D(m_pos, goal);
+
+ // If too close to the goal, do not try to optimize.
+ if (dist < 0.01f)
+ return;
+
+ // Overshoot a little. This helps to optimize open fields in tiled meshes.
+ dist = dtMin(dist+0.01f, pathOptimizationRange);
+
+ // Adjust ray length.
+ float delta[3];
+ dtVsub(delta, goal, m_pos);
+ dtVmad(goal, m_pos, delta, pathOptimizationRange/dist);
+
+ static const int MAX_RES = 32;
+ dtPolyRef res[MAX_RES];
+ float t, norm[3];
+ int nres = 0;
+ navquery->raycast(m_path[0], m_pos, goal, filter, &t, norm, res, &nres, MAX_RES);
+ if (nres > 1 && t > 0.99f)
+ {
+ m_npath = mergeCorridor(m_path, m_npath, m_maxPath, res, nres);
+ }
+}
+
+bool PathCorridor::optimizePathTopology(dtNavMeshQuery* navquery, const dtQueryFilter* filter)
+{
+ dtAssert(m_path);
+
+ if (m_npath < 3)
+ return false;
+
+ static const int MAX_ITER = 32;
+ static const int MAX_RES = 32;
+
+ dtPolyRef res[MAX_RES];
+ int nres = 0;
+ navquery->initSlicedFindPath(m_path[0], m_path[m_npath-1], m_pos, m_target, filter);
+ navquery->updateSlicedFindPath(MAX_ITER);
+ dtStatus status = navquery->finalizeSlicedFindPathPartial(m_path, m_npath, res, &nres, MAX_RES);
+
+ if (status == DT_SUCCESS && nres > 0)
+ {
+ m_npath = mergeCorridor(m_path, m_npath, m_maxPath, res, nres);
+ return true;
+ }
+
+ return false;
+}
+
+void PathCorridor::movePosition(const float* npos, dtNavMeshQuery* navquery, const dtQueryFilter* filter)
+{
+ dtAssert(m_path);
+ dtAssert(m_npath);
+
+ // Move along navmesh and update new position.
+ float result[3];
+ static const int MAX_VISITED = 16;
+ dtPolyRef visited[MAX_VISITED];
+ int nvisited = 0;
+ navquery->moveAlongSurface(m_path[0], m_pos, npos, filter,
+ result, visited, &nvisited, MAX_VISITED);
+ m_npath = fixupCorridor(m_path, m_npath, m_maxPath, visited, nvisited);
+
+ // Adjust the position to stay on top of the navmesh.
+ float h = m_pos[1];
+ navquery->getPolyHeight(m_path[0], result, &h);
+ result[1] = h;
+ dtVcopy(m_pos, result);
+}
+
+void PathCorridor::moveTargetPosition(const float* npos, dtNavMeshQuery* navquery, const dtQueryFilter* filter)
+{
+ dtAssert(m_path);
+ dtAssert(m_npath);
+
+ // Move along navmesh and update new position.
+ float result[3];
+ static const int MAX_VISITED = 16;
+ dtPolyRef visited[MAX_VISITED];
+ int nvisited = 0;
+ navquery->moveAlongSurface(m_path[m_npath-1], m_target, npos, filter,
+ result, visited, &nvisited, MAX_VISITED);
+ m_npath = fixupCorridorEnd(m_path, m_npath, m_maxPath, visited, nvisited);
+
+ // TODO: should we do that?
+ // Adjust the position to stay on top of the navmesh.
+/* float h = m_target[1];
+ navquery->getPolyHeight(m_path[m_npath-1], result, &h);
+ result[1] = h;*/
+
+ dtVcopy(m_target, result);
+}
+
+void PathCorridor::setCorridor(const float* target, const dtPolyRef* path, const int npath)
+{
+ dtAssert(m_path);
+ dtAssert(npath > 0);
+ dtAssert(npath < m_maxPath);
+
+ dtVcopy(m_target, target);
+ memcpy(m_path, path, sizeof(dtPolyRef)*npath);
+ m_npath = npath;
+}
+
+
+
+
+void Agent::integrate(const float maxAcc, const float dt)
+{
+ // Fake dynamic constraint.
+ const float maxDelta = maxAcc * dt;
+ float dv[3];
+ dtVsub(dv, nvel, vel);
+ float ds = dtVlen(dv);
+ if (ds > maxDelta)
+ dtVscale(dv, dv, maxDelta/ds);
+ dtVadd(vel, vel, dv);
+
+ // Integrate
+ if (dtVlen(vel) > 0.0001f)
+ dtVmad(npos, npos, vel, dt);
+ else
+ dtVset(vel,0,0,0);
+}
+
+float Agent::getDistanceToGoal(const float range) const
+{
+ if (!ncorners)
+ return range;
+
+ const bool endOfPath = (cornerFlags[ncorners-1] & DT_STRAIGHTPATH_END) ? true : false;
+ const bool offMeshConnection = (cornerFlags[ncorners-1] & DT_STRAIGHTPATH_OFFMESH_CONNECTION) ? true : false;
+ if (endOfPath || offMeshConnection)
+ return dtMin(dtVdist2D(npos, &cornerVerts[(ncorners-1)*3]), range);
+
+ return range;
+}
+
+void Agent::calcSmoothSteerDirection(float* dir)
+{
+ if (!ncorners)
+ {
+ dtVset(dir, 0,0,0);
+ return;
+ }
+
+ const int ip0 = 0;
+ const int ip1 = dtMin(1, ncorners-1);
+ const float* p0 = &cornerVerts[ip0*3];
+ const float* p1 = &cornerVerts[ip1*3];
+
+ float dir0[3], dir1[3];
+ dtVsub(dir0, p0, npos);
+ dtVsub(dir1, p1, npos);
+ dir0[1] = 0;
+ dir1[1] = 0;
+
+ float len0 = dtVlen(dir0);
+ float len1 = dtVlen(dir1);
+ if (len1 > 0.001f)
+ dtVscale(dir1,dir1,1.0f/len1);
+
+ dir[0] = dir0[0] - dir1[0]*len0*0.5f;
+ dir[1] = 0;
+ dir[2] = dir0[2] - dir1[2]*len0*0.5f;
+
+ dtVnormalize(dir);
+}
+
+void Agent::calcStraightSteerDirection(float* dir)
+{
+ if (!ncorners)
+ {
+ dtVset(dir, 0,0,0);
+ return;
+ }
+ dtVsub(dir, &cornerVerts[0], npos);
+ dir[1] = 0;
+ dtVnormalize(dir);
+}
+
+
+
+LocalBoundary::LocalBoundary() :
+ m_nsegs(0)
+{
+ dtVset(m_center, FLT_MAX,FLT_MAX,FLT_MAX);
+}
+
+LocalBoundary::~LocalBoundary()
+{
+}
+
+void LocalBoundary::reset()
+{
+ dtVset(m_center, FLT_MAX,FLT_MAX,FLT_MAX);
+ m_nsegs = 0;
+}
+
+void LocalBoundary::addSegment(const float dist, const float* s)
+{
+ // Insert neighbour based on the distance.
+ Segment* seg = 0;
+ if (!m_nsegs)
+ {
+ // First, trivial accept.
+ seg = &m_segs[0];
+ }
+ else if (dist >= m_segs[m_nsegs-1].d)
+ {
+ // Further than the last segment, skip.
+ if (m_nsegs >= MAX_SEGS)
+ return;
+ // Last, trivial accept.
+ seg = &m_segs[m_nsegs];
+ }
+ else
+ {
+ // Insert inbetween.
+ int i;
+ for (i = 0; i < m_nsegs; ++i)
+ if (dist <= m_segs[i].d)
+ break;
+ const int tgt = i+1;
+ const int n = dtMin(m_nsegs-i, MAX_SEGS-tgt);
+ dtAssert(tgt+n <= MAX_SEGS);
+ if (n > 0)
+ memmove(&m_segs[tgt], &m_segs[i], sizeof(Segment)*n);
+ seg = &m_segs[i];
+ }
+
+ seg->d = dist;
+ memcpy(seg->s, s, sizeof(float)*6);
+
+ if (m_nsegs < MAX_SEGS)
+ m_nsegs++;
+}
+
+void LocalBoundary::update(dtPolyRef ref, const float* pos, const float collisionQueryRange,
+ dtNavMeshQuery* navquery, const dtQueryFilter* filter)
+{
+ static const int MAX_LOCAL_POLYS = 16;
+ static const int MAX_SEGS_PER_POLY = DT_VERTS_PER_POLYGON*2;
+
+ if (!ref)
+ {
+ dtVset(m_center, FLT_MAX,FLT_MAX,FLT_MAX);
+ m_nsegs = 0;
+ return;
+ }
+
+ dtVcopy(m_center, pos);
+
+ // First query non-overlapping polygons.
+ dtPolyRef locals[MAX_LOCAL_POLYS];
+ int nlocals = 0;
+ navquery->findLocalNeighbourhood(ref, pos, collisionQueryRange,
+ filter, locals, 0, &nlocals, MAX_LOCAL_POLYS);
+
+ // Secondly, store all polygon edges.
+ m_nsegs = 0;
+ float segs[MAX_SEGS_PER_POLY*6];
+ int nsegs = 0;
+ for (int j = 0; j < nlocals; ++j)
+ {
+ navquery->getPolyWallSegments(locals[j], filter, segs, &nsegs, MAX_SEGS_PER_POLY);
+ for (int k = 0; k < nsegs; ++k)
+ {
+ const float* s = &segs[k*6];
+ // Skip too distant segments.
+ float tseg;
+ const float distSqr = dtDistancePtSegSqr2D(pos, s, s+3, tseg);
+ if (distSqr > dtSqr(collisionQueryRange))
+ continue;
+ addSegment(distSqr, s);
+ }
+ }
+}
+
+
+CrowdManager::CrowdManager() :
+ m_obstacleQuery(0),
+ m_pathResult(0),
+ m_maxPathResult(0),
+ m_totalTime(0),
+ m_rvoTime(0),
+ m_sampleCount(0),
+ m_moveRequestCount(0)
+{
+ dtVset(m_ext, 2,4,2);
+
+ m_obstacleQuery = dtAllocObstacleAvoidanceQuery();
+ m_obstacleQuery->init(6, 8);
+
+ m_obstacleQuery->setDesiredVelocityWeight(2.0f);
+ m_obstacleQuery->setCurrentVelocityWeight(0.75f);
+ m_obstacleQuery->setPreferredSideWeight(0.75f);
+ m_obstacleQuery->setCollisionTimeWeight(2.5f);
+ m_obstacleQuery->setTimeHorizon(2.5f);
+ m_obstacleQuery->setVelocitySelectionBias(0.4f);
+
+ memset(m_vodebug, 0, sizeof(m_vodebug));
+ const int maxAdaptiveSamples = (VO_ADAPTIVE_DIVS*VO_ADAPTIVE_RINGS+1)*VO_ADAPTIVE_DEPTH;
+ const int maxGridSamples = VO_GRID_SIZE*VO_GRID_SIZE;
+ const int sampleCount = dtMax(maxAdaptiveSamples, maxGridSamples);
+ for (int i = 0; i < MAX_AGENTS; ++i)
+ {
+ m_vodebug[i] = dtAllocObstacleAvoidanceDebugData();
+ m_vodebug[i]->init(sampleCount);
+ }
+
+ // Allocate temp buffer for merging paths.
+ m_maxPathResult = 256;
+ m_pathResult = (dtPolyRef*)dtAlloc(sizeof(dtPolyRef)*m_maxPathResult, DT_ALLOC_PERM);
+
+ // Alloca corridors.
+ for (int i = 0; i < MAX_AGENTS; ++i)
+ {
+ m_agents[i].corridor.init(m_maxPathResult);
+ }
+
+ // TODO: the radius should be related to the agent radius used to create the navmesh!
+ m_grid.init(100, 1.0f);
+
+ reset();
+}
+
+CrowdManager::~CrowdManager()
+{
+ delete [] m_pathResult;
+
+ for (int i = 0; i < MAX_AGENTS; ++i)
+ dtFreeObstacleAvoidanceDebugData(m_vodebug[i]);
+ dtFreeObstacleAvoidanceQuery(m_obstacleQuery);
+}
+
+void CrowdManager::reset()
+{
+ for (int i = 0; i < MAX_AGENTS; ++i)
+ m_agents[i].active = 0;
+}
+
+const int CrowdManager::getAgentCount() const
+{
+ return MAX_AGENTS;
+}
+
+const Agent* CrowdManager::getAgent(const int idx)
+{
+ return &m_agents[idx];
+}
+
+int CrowdManager::addAgent(const float* pos, const float radius, const float height, dtNavMeshQuery* navquery)
+{
+ // Find empty slot.
+ int idx = -1;
+ for (int i = 0; i < MAX_AGENTS; ++i)
+ {
+ if (!m_agents[i].active)
+ {
+ idx = i;
+ break;
+ }
+ }
+ if (idx == -1)
+ return -1;
+
+ Agent* ag = &m_agents[idx];
+
+ // Find nearest position on navmesh and place the agent there.
+ float nearest[3];
+ dtPolyRef ref;
+ navquery->findNearestPoly(pos, m_ext, &m_filter, &ref, nearest);
+ if (!ref)
+ {
+ // Could not find a location on navmesh.
+ return -1;
+ }
+
+ ag->corridor.reset(ref, nearest);
+ ag->boundary.reset();
+
+ ag->radius = radius;
+ ag->height = height;
+ ag->collisionQueryRange = radius * 8;
+ ag->pathOptimizationRange = radius * 30;
+ ag->topologyOptTime = 0;
+ ag->nneis = 0;
+
+ dtVset(ag->dvel, 0,0,0);
+ dtVset(ag->nvel, 0,0,0);
+ dtVset(ag->vel, 0,0,0);
+ dtVcopy(ag->npos, nearest);
+
+ ag->maxspeed = 0;
+ ag->t = 0;
+ dtVset(ag->opts, 0,0,0);
+ dtVset(ag->opte, 0,0,0);
+ ag->active = 1;
+ ag->var = (rand() % 10) / 9.0f;
+
+ // Init trail
+ for (int i = 0; i < AGENT_MAX_TRAIL; ++i)
+ dtVcopy(&ag->trail[i*3], ag->corridor.getPos());
+ ag->htrail = 0;
+
+ return idx;
+}
+
+void CrowdManager::removeAgent(const int idx)
+{
+ if (idx >= 0 && idx < MAX_AGENTS)
+ {
+ m_agents[idx].active = 0;
+ }
+}
+
+bool CrowdManager::requestMoveTarget(const int idx, dtPolyRef ref, const float* pos)
+{
+ if (idx < 0 || idx > MAX_AGENTS)
+ return false;
+ if (!ref)
+ return false;
+
+ MoveRequest* req = 0;
+ // Check if there is existing request and update that instead.
+ for (int i = 0; i < m_moveRequestCount; ++i)
+ {
+ if (m_moveRequests[i].idx == idx)
+ {
+ req = &m_moveRequests[i];
+ break;
+ }
+ }
+ if (!req)
+ {
+ if (m_moveRequestCount >= MAX_AGENTS)
+ return false;
+ req = &m_moveRequests[m_moveRequestCount++];
+ memset(req, 0, sizeof(MoveRequest));
+ }
+
+ // Initialize request.
+ req->idx = idx;
+ req->ref = ref;
+ dtVcopy(req->pos, pos);
+ req->pathqRef = PATHQ_INVALID;
+ req->state = MR_TARGET_REQUESTING;
+
+ req->temp[0] = ref;
+ req->ntemp = 1;
+
+ return true;
+}
+
+bool CrowdManager::adjustMoveTarget(const int idx, dtPolyRef ref, const float* pos)
+{
+ if (idx < 0 || idx > MAX_AGENTS)
+ return false;
+ if (!ref)
+ return false;
+
+ MoveRequest* req = 0;
+ // Check if there is existing request and update that instead.
+ for (int i = 0; i < m_moveRequestCount; ++i)
+ {
+ if (m_moveRequests[i].idx == idx)
+ {
+ req = &m_moveRequests[i];
+ break;
+ }
+ }
+ if (!req)
+ {
+ if (m_moveRequestCount >= MAX_AGENTS)
+ return false;
+ req = &m_moveRequests[m_moveRequestCount++];
+ memset(req, 0, sizeof(MoveRequest));
+
+ // New adjust request
+ req->state = MR_TARGET_ADJUST;
+ req->idx = idx;
+ }
+
+ // Set adjustment request.
+ req->aref = ref;
+ dtVcopy(req->apos, pos);
+
+ return true;
+}
+
+int CrowdManager::getActiveAgents(Agent** agents, const int maxAgents)
+{
+ int n = 0;
+ for (int i = 0; i < MAX_AGENTS; ++i)
+ {
+ if (!m_agents[i].active) continue;
+ if (n < maxAgents)
+ agents[n++] = &m_agents[i];
+ }
+ return n;
+}
+
+
+static int addNeighbour(const int idx, const float dist,
+ Neighbour* neis, const int nneis, const int maxNeis)
+{
+ // Insert neighbour based on the distance.
+ Neighbour* nei = 0;
+ if (!nneis)
+ {
+ nei = &neis[nneis];
+ }
+ else if (dist >= neis[nneis-1].dist)
+ {
+ if (nneis >= maxNeis)
+ return nneis;
+ nei = &neis[nneis];
+ }
+ else
+ {
+ int i;
+ for (i = 0; i < nneis; ++i)
+ if (dist <= neis[i].dist)
+ break;
+
+ const int tgt = i+1;
+ const int n = dtMin(nneis-i, maxNeis-tgt);
+
+ dtAssert(tgt+n <= maxNeis);
+
+ if (n > 0)
+ memmove(&neis[tgt], &neis[i], sizeof(Neighbour)*n);
+ nei = &neis[i];
+ }
+
+ memset(nei, 0, sizeof(Neighbour));
+
+ nei->idx = idx;
+ nei->dist = dist;
+
+ return dtMin(nneis+1, maxNeis);
+}
+
+int CrowdManager::getNeighbours(const float* pos, const float height, const float range,
+ const Agent* skip, Neighbour* result, const int maxResult)
+{
+ int n = 0;
+
+ unsigned short ids[MAX_AGENTS];
+ int nids = m_grid.queryItems(pos[0]-range, pos[2]-range,
+ pos[0]+range, pos[2]+range,
+ ids, MAX_AGENTS);
+
+ for (int i = 0; i < nids; ++i)
+ {
+ Agent* ag = &m_agents[ids[i]];
+
+ if (ag == skip) continue;
+
+ // Check for overlap.
+ float diff[3];
+ dtVsub(diff, pos, ag->npos);
+ if (fabsf(diff[1]) >= (height+ag->height)/2.0f)
+ continue;
+ diff[1] = 0;
+ const float distSqr = dtVlenSqr(diff);
+ if (distSqr > dtSqr(range))
+ continue;
+
+ n = addNeighbour(ids[i], distSqr, result, n, maxResult);
+ }
+ return n;
+}
+
+void CrowdManager::updateMoveRequest(const float dt, dtNavMeshQuery* navquery, const dtQueryFilter* filter)
+{
+ // Fire off new requests.
+ for (int i = 0; i < m_moveRequestCount; ++i)
+ {
+ MoveRequest* req = &m_moveRequests[i];
+ Agent* ag = &m_agents[req->idx];
+
+ // Agent not active anymore, kill request.
+ if (!ag->active)
+ req->state = MR_TARGET_FAILED;
+
+ // Adjust target
+ if (req->aref)
+ {
+ if (req->state == MR_TARGET_ADJUST)
+ {
+ // Adjust existing path.
+ ag->corridor.moveTargetPosition(req->apos, navquery, filter);
+ req->state = MR_TARGET_VALID;
+ }
+ else
+ {
+ // Adjust on the flight request.
+ float result[3];
+ static const int MAX_VISITED = 16;
+ dtPolyRef visited[MAX_VISITED];
+ int nvisited = 0;
+ navquery->moveAlongSurface(req->temp[req->ntemp-1], req->pos, req->apos, filter,
+ result, visited, &nvisited, MAX_VISITED);
+ req->ntemp = fixupCorridorEnd(req->temp, req->ntemp, MAX_TEMP_PATH, visited, nvisited);
+ dtVcopy(req->pos, result);
+
+ // Reset adjustment.
+ dtVset(req->apos, 0,0,0);
+ req->aref = 0;
+ }
+ }
+
+
+ if (req->state == MR_TARGET_REQUESTING)
+ {
+ // Calculate request position.
+ // If there is a lot of latency between requests, it is possible to
+ // project the current position ahead and use raycast to find the actual
+ // location and path.
+ const dtPolyRef* path = ag->corridor.getPath();
+ const int npath = ag->corridor.getPathCount();
+ dtAssert(npath);
+
+ // Here we take the simple approach and set the path to be just the current location.
+ float reqPos[3];
+ dtVcopy(reqPos, ag->corridor.getPos()); // The location of the request
+ dtPolyRef reqPath[8]; // The path to the request location
+ reqPath[0] = path[0];
+ int reqPathCount = 1;
+
+ req->pathqRef = m_pathq.request(reqPath[reqPathCount-1], req->ref, reqPos, req->pos, &m_filter);
+ if (req->pathqRef != PATHQ_INVALID)
+ {
+ ag->corridor.setCorridor(reqPos, reqPath, reqPathCount);
+ req->state = MR_TARGET_WAITING_FOR_PATH;
+ }
+ }
+ }
+
+ // Update requests.
+ m_pathq.update(navquery);
+
+
+ // Process path results.
+ for (int i = 0; i < m_moveRequestCount; ++i)
+ {
+ MoveRequest* req = &m_moveRequests[i];
+ Agent* ag = &m_agents[req->idx];
+
+ if (req->state == MR_TARGET_WAITING_FOR_PATH)
+ {
+ // Poll path queue.
+ int state = m_pathq.getRequestState(req->pathqRef);
+ if (state == PATHQ_STATE_INVALID)
+ {
+ req->pathqRef = PATHQ_INVALID;
+ req->state = MR_TARGET_FAILED;
+ }
+ else if (state == PATHQ_STATE_READY)
+ {
+ const dtPolyRef* path = ag->corridor.getPath();
+ const int npath = ag->corridor.getPathCount();
+ dtAssert(npath);
+
+ // Apply results.
+ float targetPos[3];
+ dtVcopy(targetPos, req->pos);
+
+ dtPolyRef* res = m_pathResult;
+ bool valid = true;
+ int nres = m_pathq.getPathResult(req->pathqRef, res, m_maxPathResult);
+ if (!nres)
+ valid = false;
+
+ // Merge with any target adjustment that happened during the search.
+ if (req->ntemp > 1)
+ {
+ nres = fixupCorridorEnd(res, nres, m_maxPathResult, req->temp, req->ntemp);
+ }
+
+ // Merge result and existing path.
+ // The agent might have moved whilst the request is
+ // being processed, so the path may have changed.
+ // We assume that the end of the path is at the same location
+ // where the request was issued.
+
+ // The last ref in the old path should be the same as
+ // the location where the request was issued..
+ if (valid && path[npath-1] != res[0])
+ valid = false;
+
+ if (valid)
+ {
+ // Put the old path infront of the old path.
+ if (npath > 1)
+ {
+ // Make space for the old path.
+ if ((npath-1)+nres > m_maxPathResult)
+ nres = m_maxPathResult - (npath-1);
+ memmove(res+npath-1, res, sizeof(dtPolyRef)*nres);
+ // Copy old path in the beginning.
+ memcpy(res, path, sizeof(dtPolyRef)*(npath-1));
+ nres += npath-1;
+ }
+
+ // Check for partial path.
+ if (res[nres-1] != req->ref)
+ {
+ // Partial path, constrain target position inside the last polygon.
+ float nearest[3];
+ if (navquery->closestPointOnPoly(res[nres-1], targetPos, nearest) == DT_SUCCESS)
+ dtVcopy(targetPos, nearest);
+ else
+ valid = false;
+ }
+ }
+
+ if (valid)
+ {
+ ag->corridor.setCorridor(targetPos, res, nres);
+ req->state = MR_TARGET_VALID;
+ }
+ else
+ {
+ // Something went wrong.
+ req->state = MR_TARGET_FAILED;
+ }
+ }
+ }
+
+ // Remove request when done with it.
+ if (req->state == MR_TARGET_VALID || req->state == MR_TARGET_FAILED)
+ {
+ m_moveRequestCount--;
+ if (i != m_moveRequestCount)
+ memcpy(&m_moveRequests[i], &m_moveRequests[m_moveRequestCount], sizeof(MoveRequest));
+ --i;
+ }
+ }
+
+}
+
+
+
+static int addToOptQueue(Agent* newag, Agent** agents, const int nagents, const int maxAgents)
+{
+ // Insert neighbour based on greatest time.
+ int slot = 0;
+ if (!nagents)
+ {
+ slot = nagents;
+ }
+ else if (newag->topologyOptTime <= agents[nagents-1]->topologyOptTime)
+ {
+ if (nagents >= maxAgents)
+ return nagents;
+ slot = nagents;
+ }
+ else
+ {
+ int i;
+ for (i = 0; i < nagents; ++i)
+ if (newag->topologyOptTime >= agents[i]->topologyOptTime)
+ break;
+
+ const int tgt = i+1;
+ const int n = dtMin(nagents-i, maxAgents-tgt);
+
+ dtAssert(tgt+n <= maxAgents);
+
+ if (n > 0)
+ memmove(&agents[tgt], &agents[i], sizeof(Agent*)*n);
+ slot = i;
+ }
+
+ agents[slot] = newag;
+
+ return dtMin(nagents+1, maxAgents);
+}
+
+void CrowdManager::updateTopologyOptimization(const float dt, dtNavMeshQuery* navquery, const dtQueryFilter* filter)
+{
+ Agent* agents[MAX_AGENTS];
+ int nagents = getActiveAgents(agents, MAX_AGENTS);
+ if (!nagents)
+ return;
+
+ const float OPT_TIME_THR = 0.5f; // seconds
+ const int OPT_MAX_AGENTS = 1;
+
+ Agent* queue[OPT_MAX_AGENTS];
+ int nqueue = 0;
+
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+ ag->topologyOptTime += dt;
+ if (ag->topologyOptTime >= OPT_TIME_THR)
+ {
+ nqueue = addToOptQueue(ag, queue, nqueue, OPT_MAX_AGENTS);
+ }
+ }
+
+ for (int i = 0; i < nqueue; ++i)
+ {
+ Agent* ag = queue[i];
+ ag->corridor.optimizePathTopology(navquery, filter);
+ ag->topologyOptTime = 0;
+ }
+
+}
+
+void CrowdManager::update(const float dt, unsigned int flags, dtNavMeshQuery* navquery)
+{
+ m_sampleCount = 0;
+ m_totalTime = 0;
+ m_rvoTime = 0;
+
+ if (!navquery)
+ return;
+
+ TimeVal startTime = getPerfTime();
+
+ Agent* agents[MAX_AGENTS];
+ int nagents = getActiveAgents(agents, MAX_AGENTS);
+
+ static const float MAX_ACC = 8.0f;
+ static const float MAX_SPEED = 3.5f;
+
+ // Update async move request and path finder.
+ updateMoveRequest(dt, navquery, &m_filter);
+
+ // Optimize path topology.
+ if (flags & CROWDMAN_OPTIMIZE_TOPO)
+ updateTopologyOptimization(dt, navquery, &m_filter);
+
+ // Register agents to proximity grid.
+ m_grid.clear();
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+ const float* p = ag->npos;
+ const float r = ag->radius;
+ m_grid.addItem((unsigned short)i, p[0]-r, p[2]-r, p[0]+r, p[2]+r);
+ }
+
+ // Get nearby navmesh segments and agents to collide with.
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+ // Only update the collision boundary after certain distance has been passed.
+ if (dtVdist2DSqr(ag->npos, ag->boundary.getCenter()) > dtSqr(ag->collisionQueryRange*0.25f))
+ ag->boundary.update(ag->corridor.getFirstPoly(), ag->npos, ag->collisionQueryRange, navquery, &m_filter);
+ // Query neighbour agents
+ ag->nneis = getNeighbours(ag->npos, ag->height, ag->collisionQueryRange, ag, ag->neis, AGENT_MAX_NEIGHBOURS);
+ }
+
+ // Find next corner to steer to.
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+
+ // Find corners for steering
+ ag->ncorners = ag->corridor.findCorners(ag->cornerVerts, ag->cornerFlags, ag->cornerPolys,
+ AGENT_MAX_CORNERS, navquery, &m_filter);
+
+ // Check to see if the corner after the next corner is directly visible,
+ // and short cut to there.
+ if ((flags & CROWDMAN_OPTIMIZE_VIS) && ag->ncorners > 0)
+ {
+ const float* target = &ag->cornerVerts[dtMin(1,ag->ncorners-1)*3];
+ dtVcopy(ag->opts, ag->corridor.getPos());
+ dtVcopy(ag->opte, target);
+ ag->corridor.optimizePathVisibility(target, ag->pathOptimizationRange, navquery, &m_filter);
+ }
+ else
+ {
+ dtVset(ag->opts, 0,0,0);
+ dtVset(ag->opte, 0,0,0);
+ }
+
+ // Copy data for debug purposes.
+ }
+
+ // Calculate steering.
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+
+ float dvel[3] = {0,0,0};
+
+ // Calculate steering direction.
+ if (flags & CROWDMAN_ANTICIPATE_TURNS)
+ ag->calcSmoothSteerDirection(dvel);
+ else
+ ag->calcStraightSteerDirection(dvel);
+
+ // Calculate speed scale, which tells the agent to slowdown at the end of the path.
+ const float slowDownRadius = ag->radius*2; // TODO: make less hacky.
+ const float speedScale = ag->getDistanceToGoal(slowDownRadius) / slowDownRadius;
+
+ // Apply style.
+ if (flags & CROWDMAN_DRUNK)
+ {
+ // Drunken steering
+
+ // Pulsating speed.
+ ag->t += dt * (1.0f - ag->var*0.25f);
+ ag->maxspeed = MAX_SPEED*(1 + dtSqr(cosf(ag->t*2.0f))*0.3f);
+
+ dtVscale(dvel, dvel, ag->maxspeed * speedScale);
+
+ // Slightly wandering steering.
+ const float amp = cosf(ag->var*13.69f+ag->t*3.123f) * 0.2f;
+ const float nx = -dvel[2];
+ const float nz = dvel[0];
+ dvel[0] += nx*amp;
+ dvel[2] += nz*amp;
+ }
+ else
+ {
+ // Normal steering.
+ ag->maxspeed = MAX_SPEED;
+ dtVscale(dvel, dvel, ag->maxspeed * speedScale);
+ }
+
+ // Set the desired velocity.
+ dtVcopy(ag->dvel, dvel);
+ }
+
+ // Velocity planning.
+ TimeVal rvoStartTime = getPerfTime();
+
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+
+ if (flags & CROWDMAN_USE_VO)
+ {
+ m_obstacleQuery->reset();
+
+ // Add neighbours as obstacles.
+ for (int j = 0; j < ag->nneis; ++j)
+ {
+ const Agent* nei = &m_agents[ag->neis[j].idx];
+ m_obstacleQuery->addCircle(nei->npos, nei->radius, nei->vel, nei->dvel);
+ }
+
+ // Append neighbour segments as obstacles.
+ for (int j = 0; j < ag->boundary.getSegmentCount(); ++j)
+ {
+ const float* s = ag->boundary.getSegment(j);
+ if (dtTriArea2D(ag->npos, s, s+3) < 0.0f)
+ continue;
+ m_obstacleQuery->addSegment(s, s+3);
+ }
+
+ // Sample new safe velocity.
+ bool adaptive = true;
+
+ if (adaptive)
+ {
+ m_obstacleQuery->sampleVelocityAdaptive(ag->npos, ag->radius, ag->maxspeed,
+ ag->vel, ag->dvel, ag->nvel,
+ VO_ADAPTIVE_DIVS, VO_ADAPTIVE_RINGS, VO_ADAPTIVE_DEPTH,
+ m_vodebug[i]);
+ }
+ else
+ {
+ m_obstacleQuery->sampleVelocityGrid(ag->npos, ag->radius, ag->maxspeed,
+ ag->vel, ag->dvel, ag->nvel,
+ VO_GRID_SIZE, m_vodebug[i]);
+ }
+ }
+ else
+ {
+ // If not using velocity planning, new velocity is directly the desired velocity.
+ dtVcopy(ag->nvel, ag->dvel);
+ }
+ }
+ TimeVal rvoEndTime = getPerfTime();
+
+ // Integrate.
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+ ag->integrate(MAX_ACC, dt);
+ }
+
+ // Handle collisions.
+ for (int iter = 0; iter < 4; ++iter)
+ {
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+
+ dtVset(ag->disp, 0,0,0);
+
+ float w = 0;
+
+ for (int j = 0; j < ag->nneis; ++j)
+ {
+ const Agent* nei = &m_agents[ag->neis[j].idx];
+
+ float diff[3];
+ dtVsub(diff, ag->npos, nei->npos);
+
+ if (fabsf(diff[1]) >= (ag->height+ nei->height)/2.0f)
+ continue;
+
+ diff[1] = 0;
+
+ float dist = dtVlenSqr(diff);
+ if (dist > dtSqr(ag->radius + nei->radius))
+ continue;
+ dist = sqrtf(dist);
+ float pen = (ag->radius + nei->radius) - dist;
+ if (dist > 0.0001f)
+ pen = (1.0f/dist) * (pen*0.5f) * 0.7f;
+
+ dtVmad(ag->disp, ag->disp, diff, pen);
+
+ w += 1.0f;
+ }
+
+ if (w > 0.0001f)
+ {
+ const float iw = 1.0f / w;
+ dtVscale(ag->disp, ag->disp, iw);
+ }
+ }
+
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+ dtVadd(ag->npos, ag->npos, ag->disp);
+ }
+ }
+
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+ // Move along navmesh.
+ ag->corridor.movePosition(ag->npos, navquery, &m_filter);
+ // Get valid constrained position back.
+ dtVcopy(ag->npos, ag->corridor.getPos());
+ }
+
+ TimeVal endTime = getPerfTime();
+
+ // Debug/demo book keeping
+ int ns = 0;
+ for (int i = 0; i < nagents; ++i)
+ {
+ Agent* ag = agents[i];
+
+ if (flags & CROWDMAN_USE_VO)
+ {
+ // Normalize samples for debug draw
+ m_vodebug[i]->normalizeSamples();
+ ns += m_vodebug[i]->getSampleCount();
+ }
+
+ // Update agent movement trail.
+ ag->htrail = (ag->htrail + 1) % AGENT_MAX_TRAIL;
+ dtVcopy(&ag->trail[ag->htrail*3], ag->npos);
+ }
+
+ m_sampleCount = ns;
+ m_rvoTime = getPerfDeltaTimeUsec(rvoStartTime, rvoEndTime);
+ m_totalTime = getPerfDeltaTimeUsec(startTime, endTime);
+}
+
+
diff --git a/dep/recastnavigation/RecastDemo/Source/CrowdTool.cpp b/dep/recastnavigation/RecastDemo/Source/CrowdTool.cpp
new file mode 100644
index 000000000..9a739d655
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/CrowdTool.cpp
@@ -0,0 +1,642 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#define _USE_MATH_DEFINES
+#include
+#include
+#include
+#include
+#include "SDL.h"
+#include "SDL_opengl.h"
+#include "imgui.h"
+#include "CrowdTool.h"
+#include "InputGeom.h"
+#include "Sample.h"
+#include "DetourDebugDraw.h"
+#include "DetourObstacleAvoidance.h"
+#include "DetourCommon.h"
+#include "SampleInterfaces.h"
+#include "CrowdManager.h"
+
+#ifdef WIN32
+# define snprintf _snprintf
+#endif
+
+
+static bool isectSegAABB(const float* sp, const float* sq,
+ const float* amin, const float* amax,
+ float& tmin, float& tmax)
+{
+ static const float EPS = 1e-6f;
+
+ float d[3];
+ dtVsub(d, sq, sp);
+ tmin = 0; // set to -FLT_MAX to get first hit on line
+ tmax = FLT_MAX; // set to max distance ray can travel (for segment)
+
+ // For all three slabs
+ for (int i = 0; i < 3; i++)
+ {
+ if (fabsf(d[i]) < EPS)
+ {
+ // Ray is parallel to slab. No hit if origin not within slab
+ if (sp[i] < amin[i] || sp[i] > amax[i])
+ return false;
+ }
+ else
+ {
+ // Compute intersection t value of ray with near and far plane of slab
+ const float ood = 1.0f / d[i];
+ float t1 = (amin[i] - sp[i]) * ood;
+ float t2 = (amax[i] - sp[i]) * ood;
+ // Make t1 be intersection with near plane, t2 with far plane
+ if (t1 > t2) dtSwap(t1, t2);
+ // Compute the intersection of slab intersections intervals
+ if (t1 > tmin) tmin = t1;
+ if (t2 < tmax) tmax = t2;
+ // Exit with no collision as soon as slab intersection becomes empty
+ if (tmin > tmax) return false;
+ }
+ }
+
+ return true;
+}
+
+static void getAgentBounds(const Agent* ag, float* bmin, float* bmax)
+{
+ const float* p = ag->npos;
+ const float r = ag->radius;
+ const float h = ag->height;
+ bmin[0] = p[0] - r;
+ bmin[1] = p[1];
+ bmin[2] = p[2] - r;
+ bmax[0] = p[0] + r;
+ bmax[1] = p[1] + h;
+ bmax[2] = p[2] + r;
+}
+
+CrowdTool::CrowdTool() :
+ m_sample(0),
+ m_oldFlags(0),
+ m_targetRef(0),
+ m_expandDebugDraw(false),
+ m_showLabels(false),
+ m_showCorners(false),
+ m_showTargets(false),
+ m_showCollisionSegments(false),
+ m_showPath(false),
+ m_showVO(false),
+ m_showOpt(false),
+ m_showGrid(false),
+ m_showNodes(false),
+ m_showPerfGraph(false),
+ m_expandOptions(true),
+ m_anticipateTurns(true),
+ m_optimizeVis(true),
+ m_optimizeTopo(true),
+ m_useVO(true),
+ m_drunkMove(false),
+ m_run(true),
+ m_mode(TOOLMODE_CREATE)
+{
+}
+
+CrowdTool::~CrowdTool()
+{
+ if (m_sample)
+ {
+ m_sample->setNavMeshDrawFlags(m_oldFlags);
+ }
+}
+
+void CrowdTool::init(Sample* sample)
+{
+ if (m_sample != sample)
+ {
+ m_sample = sample;
+ m_oldFlags = m_sample->getNavMeshDrawFlags();
+ m_sample->setNavMeshDrawFlags(m_oldFlags & ~DU_DRAWNAVMESH_CLOSEDLIST);
+ }
+}
+
+void CrowdTool::reset()
+{
+ m_targetRef = 0;
+}
+
+void CrowdTool::handleMenu()
+{
+
+ if (imguiCheck("Create Agents", m_mode == TOOLMODE_CREATE))
+ m_mode = TOOLMODE_CREATE;
+ if (imguiCheck("Move Target", m_mode == TOOLMODE_MOVE_TARGET))
+ m_mode = TOOLMODE_MOVE_TARGET;
+
+ imguiSeparator();
+
+ if (m_mode == TOOLMODE_CREATE)
+ {
+ imguiValue("Click to add agents.");
+ imguiValue("Shift+Click to remove.");
+ }
+ else if (m_mode == TOOLMODE_MOVE_TARGET)
+ {
+ imguiValue("Click to set move target.");
+ imguiValue("Shift+Click to adjust target.");
+ imguiValue("Adjusting uses special pathfinder");
+ imguiValue("which is really fast to change the");
+ imguiValue("target in small increments.");
+ }
+
+ imguiSeparator();
+ imguiSeparator();
+
+ if (imguiCollapse("Options", 0, m_expandOptions))
+ m_expandOptions = !m_expandOptions;
+
+ if (m_expandOptions)
+ {
+ imguiIndent();
+ if (imguiCheck("Optimize Visibility", m_optimizeVis))
+ m_optimizeVis = !m_optimizeVis;
+ if (imguiCheck("Optimize Topology", m_optimizeTopo))
+ m_optimizeTopo = !m_optimizeTopo;
+ if (imguiCheck("Anticipate Turns", m_anticipateTurns))
+ m_anticipateTurns = !m_anticipateTurns;
+ if (imguiCheck("Use VO", m_useVO))
+ m_useVO = !m_useVO;
+ if (imguiCheck("Drunk Move", m_drunkMove))
+ m_drunkMove = !m_drunkMove;
+ imguiUnindent();
+ }
+
+ if (imguiCollapse("Debug Draw", 0, m_expandDebugDraw))
+ m_expandDebugDraw = !m_expandDebugDraw;
+
+ if (m_expandDebugDraw)
+ {
+ imguiIndent();
+ if (imguiCheck("Show Labels", m_showLabels))
+ m_showLabels = !m_showLabels;
+ if (imguiCheck("Show Corners", m_showCorners))
+ m_showCorners = !m_showCorners;
+ if (imguiCheck("Show Targets", m_showTargets))
+ m_showTargets = !m_showTargets;
+ if (imguiCheck("Show Collision Segs", m_showCollisionSegments))
+ m_showCollisionSegments = !m_showCollisionSegments;
+ if (imguiCheck("Show Path", m_showPath))
+ m_showPath = !m_showPath;
+ if (imguiCheck("Show VO", m_showVO))
+ m_showVO = !m_showVO;
+ if (imguiCheck("Show Path Optimization", m_showOpt))
+ m_showOpt = !m_showOpt;
+ if (imguiCheck("Show Prox Grid", m_showGrid))
+ m_showGrid = !m_showGrid;
+ if (imguiCheck("Show Nodes", m_showNodes))
+ m_showNodes = !m_showNodes;
+ if (imguiCheck("Show Perf Graph", m_showPerfGraph))
+ m_showPerfGraph = !m_showPerfGraph;
+ imguiUnindent();
+ }
+}
+
+void CrowdTool::handleClick(const float* s, const float* p, bool shift)
+{
+ if (!m_sample) return;
+ InputGeom* geom = m_sample->getInputGeom();
+ if (!geom) return;
+
+ if (m_mode == TOOLMODE_CREATE)
+ {
+ if (shift)
+ {
+ // Delete
+ int isel = -1;
+ float tsel = FLT_MAX;
+
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+ float bmin[3], bmax[3];
+ getAgentBounds(ag, bmin, bmax);
+ float tmin, tmax;
+ if (isectSegAABB(s, p, bmin,bmax, tmin, tmax))
+ {
+ if (tmin > 0 && tmin < tsel)
+ {
+ isel = i;
+ tsel = tmin;
+ }
+ }
+ }
+ if (isel != -1)
+ {
+ m_crowd.removeAgent(isel);
+ }
+ }
+ else
+ {
+ // Add
+ dtNavMeshQuery* navquery = m_sample->getNavMeshQuery();
+ int idx = m_crowd.addAgent(p, m_sample->getAgentRadius(), m_sample->getAgentHeight(), navquery);
+ if (idx != -1 && m_targetRef)
+ m_crowd.requestMoveTarget(idx, m_targetRef, m_targetPos);
+ }
+ }
+ else if (m_mode == TOOLMODE_MOVE_TARGET)
+ {
+ // Find nearest point on navmesh and set move request to that location.
+ dtNavMeshQuery* navquery = m_sample->getNavMeshQuery();
+ const dtQueryFilter* filter = m_crowd.getFilter();
+ const float* ext = m_crowd.getQueryExtents();
+
+ navquery->findNearestPoly(p, ext, filter, &m_targetRef, m_targetPos);
+
+ if (shift)
+ {
+ // Adjust target using tiny local search.
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+ m_crowd.adjustMoveTarget(i, m_targetRef, m_targetPos);
+ }
+ }
+ else
+ {
+ // Move target using paht finder
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+ m_crowd.requestMoveTarget(i, m_targetRef, m_targetPos);
+ }
+ }
+ }
+}
+
+void CrowdTool::handleStep()
+{
+}
+
+void CrowdTool::handleToggle()
+{
+ m_run = !m_run;
+}
+
+void CrowdTool::handleUpdate(const float dt)
+{
+ if (!m_sample) return;
+ if (!m_sample->getNavMesh()) return;
+ if (m_run)
+ {
+ unsigned int flags = 0;
+
+ if (m_anticipateTurns)
+ flags |= CROWDMAN_ANTICIPATE_TURNS;
+ if (m_useVO)
+ flags |= CROWDMAN_USE_VO;
+ if (m_drunkMove)
+ flags |= CROWDMAN_DRUNK;
+ if (m_optimizeVis)
+ flags |= CROWDMAN_OPTIMIZE_VIS;
+ if (m_optimizeTopo)
+ flags |= CROWDMAN_OPTIMIZE_TOPO;
+
+ m_crowd.update(dt, flags, m_sample->getNavMeshQuery());
+
+ m_crowdSampleCount.addSample((float)m_crowd.getSampleCount());
+ m_crowdTotalTime.addSample(m_crowd.getTotalTime() / 1000.0f);
+ m_crowdRvoTime.addSample(m_crowd.getRVOTime() / 1000.0f);
+ }
+}
+
+void CrowdTool::handleRender()
+{
+ DebugDrawGL dd;
+ const float s = m_sample->getAgentRadius();
+
+ dtNavMesh* nmesh = m_sample->getNavMesh();
+ if (!nmesh)
+ return;
+
+ dtNavMeshQuery* navquery = m_sample->getNavMeshQuery();
+
+ if (m_showNodes)
+ {
+ if (navquery)
+ duDebugDrawNavMeshNodes(&dd, *navquery);
+ }
+
+ dd.depthMask(false);
+
+ // Draw paths
+ if (m_showPath)
+ {
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+
+ const dtPolyRef* path = ag->corridor.getPath();
+ const int npath = ag->corridor.getPathCount();
+ for (int i = 0; i < npath; ++i)
+ duDebugDrawNavMeshPoly(&dd, *nmesh, path[i], duRGBA(0,0,0,32));
+ }
+ }
+
+ if (m_targetRef)
+ duDebugDrawCross(&dd, m_targetPos[0],m_targetPos[1]+0.1f,m_targetPos[2], s, duRGBA(255,255,255,192), 2.0f);
+
+ // Occupancy grid.
+ if (m_showGrid)
+ {
+ float gridy = -FLT_MAX;
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+ const float* pos = ag->corridor.getPos();
+ gridy = dtMax(gridy, pos[1]);
+ }
+ gridy += 1.0f;
+
+ dd.begin(DU_DRAW_QUADS);
+ const ProximityGrid* grid = m_crowd.getGrid();
+ const int* bounds = grid->getBounds();
+ const float cs = grid->getCellSize();
+ for (int y = bounds[1]; y <= bounds[3]; ++y)
+ {
+ for (int x = bounds[0]; x <= bounds[2]; ++x)
+ {
+ const int count = grid->getItemCountAt(x,y);
+ if (!count) continue;
+ unsigned int col = duRGBA(128,0,0,dtMin(count*40,255));
+ dd.vertex(x*cs, gridy, y*cs, col);
+ dd.vertex(x*cs, gridy, y*cs+cs, col);
+ dd.vertex(x*cs+cs, gridy, y*cs+cs, col);
+ dd.vertex(x*cs+cs, gridy, y*cs, col);
+ }
+ }
+ dd.end();
+ }
+
+ // Trail
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+
+ const float* pos = ag->npos;
+
+ dd.begin(DU_DRAW_LINES,3.0f);
+ float prev[3], preva = 1;
+ dtVcopy(prev, pos);
+ for (int j = 0; j < AGENT_MAX_TRAIL-1; ++j)
+ {
+ const int idx = (ag->htrail + AGENT_MAX_TRAIL-j) % AGENT_MAX_TRAIL;
+ const float* v = &ag->trail[idx*3];
+ float a = 1 - j/(float)AGENT_MAX_TRAIL;
+ dd.vertex(prev[0],prev[1]+0.1f,prev[2], duRGBA(0,0,0,(int)(128*preva)));
+ dd.vertex(v[0],v[1]+0.1f,v[2], duRGBA(0,0,0,(int)(128*a)));
+ preva = a;
+ dtVcopy(prev, v);
+ }
+ dd.end();
+
+ }
+
+ // Corners & co
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+
+ const float radius = ag->radius;
+ const float* pos = ag->npos;
+
+ if (m_showCorners)
+ {
+ if (ag->ncorners)
+ {
+ dd.begin(DU_DRAW_LINES, 2.0f);
+ for (int j = 0; j < ag->ncorners; ++j)
+ {
+ const float* va = j == 0 ? pos : &ag->cornerVerts[(j-1)*3];
+ const float* vb = &ag->cornerVerts[j*3];
+ dd.vertex(va[0],va[1]+radius,va[2], duRGBA(128,0,0,192));
+ dd.vertex(vb[0],vb[1]+radius,vb[2], duRGBA(128,0,0,192));
+ }
+ dd.end();
+
+ if (m_anticipateTurns)
+ {
+ /* float dvel[3], pos[3];
+ calcSmoothSteerDirection(ag->pos, ag->cornerVerts, ag->ncorners, dvel);
+ pos[0] = ag->pos[0] + dvel[0];
+ pos[1] = ag->pos[1] + dvel[1];
+ pos[2] = ag->pos[2] + dvel[2];
+
+ const float off = ag->radius+0.1f;
+ const float* tgt = &ag->cornerVerts[0];
+ const float y = ag->pos[1]+off;
+
+ dd.begin(DU_DRAW_LINES, 2.0f);
+
+ dd.vertex(ag->pos[0],y,ag->pos[2], duRGBA(255,0,0,192));
+ dd.vertex(pos[0],y,pos[2], duRGBA(255,0,0,192));
+
+ dd.vertex(pos[0],y,pos[2], duRGBA(255,0,0,192));
+ dd.vertex(tgt[0],y,tgt[2], duRGBA(255,0,0,192));
+
+ dd.end();*/
+ }
+ }
+ }
+
+ if (m_showCollisionSegments)
+ {
+ const float* center = ag->boundary.getCenter();
+ duDebugDrawCross(&dd, center[0],center[1]+radius,center[2], 0.2f, duRGBA(192,0,128,255), 2.0f);
+ duDebugDrawCircle(&dd, center[0],center[1]+radius,center[2], ag->collisionQueryRange,
+ duRGBA(192,0,128,128), 2.0f);
+
+ dd.begin(DU_DRAW_LINES, 3.0f);
+ for (int j = 0; j < ag->boundary.getSegmentCount(); ++j)
+ {
+ const float* s = ag->boundary.getSegment(j);
+ unsigned int col = duRGBA(192,0,128,192);
+ if (dtTriArea2D(pos, s, s+3) < 0.0f)
+ col = duDarkenCol(col);
+
+ duAppendArrow(&dd, s[0],s[1]+0.2f,s[2], s[3],s[4]+0.2f,s[5], 0.0f, 0.3f, col);
+ }
+ dd.end();
+ }
+
+ if (m_showOpt)
+ {
+ dd.begin(DU_DRAW_LINES, 2.0f);
+ dd.vertex(ag->opts[0],ag->opts[1]+0.3f,ag->opts[2], duRGBA(0,128,0,192));
+ dd.vertex(ag->opte[0],ag->opte[1]+0.3f,ag->opte[2], duRGBA(0,128,0,192));
+ dd.end();
+ }
+ }
+
+ // Agent cylinders.
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+
+ const float radius = ag->radius;
+ const float* pos = ag->npos;
+
+ duDebugDrawCircle(&dd, pos[0], pos[1], pos[2], radius, duRGBA(0,0,0,32), 2.0f);
+ }
+
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+
+ const float height = ag->height;
+ const float radius = ag->radius;
+ const float* pos = ag->npos;
+
+ duDebugDrawCylinder(&dd, pos[0]-radius, pos[1]+radius*0.1f, pos[2]-radius,
+ pos[0]+radius, pos[1]+height, pos[2]+radius,
+ duRGBA(220,220,220,128));
+ }
+
+
+ // Velocity stuff.
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+
+ const float radius = ag->radius;
+ const float height = ag->height;
+ const float* pos = ag->npos;
+ const float* vel = ag->vel;
+ const float* dvel = ag->dvel;
+
+ duDebugDrawCircle(&dd, pos[0], pos[1]+height, pos[2], radius, duRGBA(220,220,220,192), 2.0f);
+
+ if (m_showVO)
+ {
+ // Draw detail about agent sela
+ const dtObstacleAvoidanceDebugData* debug = m_crowd.getVODebugData(i);
+
+ const float dx = pos[0];
+ const float dy = pos[1]+height;
+ const float dz = pos[2];
+
+ dd.begin(DU_DRAW_QUADS);
+ for (int i = 0; i < debug->getSampleCount(); ++i)
+ {
+ const float* p = debug->getSampleVelocity(i);
+ const float sr = debug->getSampleSize(i);
+ const float pen = debug->getSamplePenalty(i);
+ const float pen2 = debug->getSamplePreferredSidePenalty(i);
+ unsigned int col = duLerpCol(duRGBA(255,255,255,220), duRGBA(128,96,0,220), (int)(pen*255));
+ col = duLerpCol(col, duRGBA(128,0,0,220), (int)(pen2*128));
+ dd.vertex(dx+p[0]-sr, dy, dz+p[2]-sr, col);
+ dd.vertex(dx+p[0]-sr, dy, dz+p[2]+sr, col);
+ dd.vertex(dx+p[0]+sr, dy, dz+p[2]+sr, col);
+ dd.vertex(dx+p[0]+sr, dy, dz+p[2]-sr, col);
+ }
+ dd.end();
+
+ }
+
+ duDebugDrawArrow(&dd, pos[0],pos[1]+height,pos[2],
+ pos[0]+dvel[0],pos[1]+height+dvel[1],pos[2]+dvel[2],
+ 0.0f, 0.4f, duRGBA(0,192,255,192), 1.0f);
+
+ duDebugDrawArrow(&dd, pos[0],pos[1]+height,pos[2],
+ pos[0]+vel[0],pos[1]+height+vel[1],pos[2]+vel[2],
+ 0.0f, 0.4f, duRGBA(0,0,0,192), 2.0f);
+ }
+
+ // Targets
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+
+ const float* pos = ag->npos;
+ const float* target = ag->corridor.getTarget();
+
+ if (m_showTargets)
+ {
+ duDebugDrawArc(&dd, pos[0], pos[1], pos[2], target[0], target[1], target[2],
+ 0.25f, 0, 0.4f, duRGBA(0,0,0,128), 1.0f);
+ }
+ }
+
+ dd.depthMask(true);
+}
+
+void CrowdTool::handleRenderOverlay(double* proj, double* model, int* view)
+{
+ GLdouble x, y, z;
+
+ // Draw start and end point labels
+ if (m_targetRef && gluProject((GLdouble)m_targetPos[0], (GLdouble)m_targetPos[1], (GLdouble)m_targetPos[2],
+ model, proj, view, &x, &y, &z))
+ {
+ imguiDrawText((int)x, (int)(y+25), IMGUI_ALIGN_CENTER, "TARGET", imguiRGBA(0,0,0,220));
+ }
+
+ if (m_showLabels)
+ {
+ char label[32];
+ for (int i = 0; i < m_crowd.getAgentCount(); ++i)
+ {
+ const Agent* ag = m_crowd.getAgent(i);
+ if (!ag->active) continue;
+ const float* pos = ag->npos;
+ const float h = ag->height;
+ if (gluProject((GLdouble)pos[0], (GLdouble)pos[1]+h, (GLdouble)pos[2],
+ model, proj, view, &x, &y, &z))
+ {
+ snprintf(label, 32, "%d", i);
+ imguiDrawText((int)x, (int)y+15, IMGUI_ALIGN_CENTER, label, imguiRGBA(0,0,0,220));
+ }
+
+ }
+ }
+
+ if (m_showPerfGraph)
+ {
+ GraphParams gp;
+ gp.setRect(300, 10, 500, 200, 8);
+ gp.setValueRange(0.0f, 2.0f, 4, "ms");
+
+ drawGraphBackground(&gp);
+ drawGraph(&gp, &m_crowdRvoTime, 0, "RVO Sampling", duRGBA(255,0,128,255));
+ drawGraph(&gp, &m_crowdTotalTime, 1, "Total", duRGBA(128,255,0,255));
+
+ gp.setRect(300, 10, 500, 50, 8);
+ gp.setValueRange(0.0f, 2000.0f, 1, "0");
+ drawGraph(&gp, &m_crowdSampleCount, 0, "Sample Count", duRGBA(255,255,255,255));
+ }
+}
diff --git a/dep/recastnavigation/RecastDemo/Source/Debug.cpp b/dep/recastnavigation/RecastDemo/Source/Debug.cpp
new file mode 100644
index 000000000..744f188b1
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/Debug.cpp
@@ -0,0 +1,373 @@
+
+#include "Debug.h"
+
+#include
+#include "DetourNavMesh.h"
+#include "Recast.h"
+
+#include
+using namespace std;
+
+void duReadNavMesh(char* tile, dtNavMesh* &navMesh)
+{
+ FILE* file;
+
+ string tileName(tile);
+ tileName = tileName.substr(0, tileName.find_first_of('.'));
+ string mapName = "mmaps/" + tileName.substr(0, 3) + ".mmap";
+ file = fopen(mapName.c_str(), "rb");
+
+ if(!file)
+ return;
+
+ dtNavMeshParams params;
+ fread(¶ms, sizeof(dtNavMeshParams), 1, file);
+ fclose(file);
+
+ if (!navMesh)
+ {
+ dtFreeNavMesh(navMesh);
+ navMesh = dtAllocNavMesh();
+ navMesh->init(¶ms);
+ }
+
+ int map = atoi(tileName.substr(0, 3).c_str());
+ int x = atoi(tileName.substr(5, 2).c_str());
+ int y = atoi(tileName.substr(3, 2).c_str());
+ bool loaded = false;
+
+ char fname[50];
+
+ int count = 0;
+ for (int i = x-1; i <= x+1; ++i)
+ for (int j = y-1; j <= y+1; ++j)
+ //int i = x;
+ //int j = y;
+ {
+ sprintf(fname, "mmaps/%03i%02i%02i.mmtile", map, j, i);
+ file = fopen(fname, "rb");
+ if(file)
+ {
+ MmapTileHeader header;
+ fread(&header, sizeof(MmapTileHeader), 1, file);
+
+ unsigned char* data = (unsigned char*)dtAlloc(header.size, DT_ALLOC_PERM);
+ fread(data, header.size, 1, file);
+
+ dtStatus status = navMesh->addTile(data, header.size, DT_TILE_FREE_DATA, 0 , NULL);
+
+ if (status != DT_SUCCESS)
+ dtFree(data);
+ else
+ count++;
+
+ fclose(file);
+ }
+ }
+
+ if (!count)
+ {
+ dtFreeNavMesh(navMesh);
+ navMesh = NULL;
+ }
+}
+
+int duReadHeightfield(char* tile, rcHeightfield* &hf)
+{
+ FILE* file;
+
+ string tileName(tile);
+ tileName = tileName.substr(0, tileName.find_first_of('.'));
+ file = fopen(("meshes/" + tileName + ".hf").c_str(), "rb");
+
+ if(!file)
+ return false;
+
+ hf = rcAllocHeightfield();
+
+ fread(&(hf->cs), sizeof(float), 1, file);
+ fread(&(hf->ch), sizeof(float), 1, file);
+ fread(&(hf->width), sizeof(int), 1, file);
+ fread(&(hf->height), sizeof(int), 1, file);
+ fread(hf->bmin, sizeof(float), 3, file);
+ fread(hf->bmax, sizeof(float), 3, file);
+
+ hf->spans = new rcSpan*[hf->width*hf->height];
+ memset(hf->spans, 0, sizeof(rcSpan*)*hf->width*hf->height);
+
+ for(int y = 0; y < hf->height; ++y)
+ for(int x = 0; x < hf->width; ++x)
+ {
+ int spanCount;
+ fread(&spanCount, sizeof(int), 1, file);
+
+ if(spanCount)
+ hf->spans[x + y*hf->width] = new rcSpan;
+ else
+ hf->spans[x + y*hf->width] = NULL;
+
+ rcSpan* span = hf->spans[x + y*hf->width];
+
+ while(spanCount--)
+ {
+ fread(span, sizeof(rcSpan), 1, file);
+
+ if(spanCount)
+ {
+ span->next = new rcSpan;
+ span = span->next;
+ }
+ else
+ span->next = NULL;
+ }
+ }
+
+ fclose(file);
+
+ return false;
+}
+
+int duReadCompactHeightfield(char* tile, rcCompactHeightfield* &chf)
+{
+ FILE* file;
+
+ string tileName(tile);
+ tileName = tileName.substr(0, tileName.find_first_of('.'));
+ file = fopen(("meshes/" + tileName + ".chf").c_str(), "rb");
+
+ if(!file)
+ return false;
+
+ chf = rcAllocCompactHeightfield();
+
+ fread(&chf->width, sizeof(chf->width), 1, file);
+ fread(&chf->height, sizeof(chf->height), 1, file);
+ fread(&chf->spanCount, sizeof(chf->spanCount), 1, file);
+
+ fread(&chf->walkableHeight, sizeof(chf->walkableHeight), 1, file);
+ fread(&chf->walkableClimb, sizeof(chf->walkableClimb), 1, file);
+
+ fread(&chf->maxDistance, sizeof(chf->maxDistance), 1, file);
+ fread(&chf->maxRegions, sizeof(chf->maxRegions), 1, file);
+
+ fread(chf->bmin, sizeof(chf->bmin), 1, file);
+ fread(chf->bmax, sizeof(chf->bmax), 1, file);
+
+ fread(&chf->cs, sizeof(chf->cs), 1, file);
+ fread(&chf->ch, sizeof(chf->ch), 1, file);
+
+ int tmp = 0;
+ fread(&tmp, sizeof(tmp), 1, file);
+
+ if (tmp & 1)
+ {
+ chf->cells = new rcCompactCell[chf->width*chf->height];
+ fread(chf->cells, sizeof(rcCompactCell), chf->width*chf->height, file);
+ }
+ if (tmp & 2)
+ {
+ chf->spans = new rcCompactSpan[chf->spanCount];
+ fread(chf->spans, sizeof(rcCompactSpan), chf->spanCount, file);
+ }
+ if (tmp & 4)
+ {
+ chf->dist = new unsigned short[chf->spanCount];
+ fread(chf->dist, sizeof(unsigned short), chf->spanCount, file);
+ }
+ if (tmp & 8)
+ {
+ chf->areas = new unsigned char[chf->spanCount];
+ fread(chf->areas, sizeof(unsigned char), chf->spanCount, file);
+ }
+
+ fclose(file);
+
+ return false;
+}
+
+int duReadContourSet(char* tile, rcContourSet* &cs)
+{
+ FILE* file;
+
+ string tileName(tile);
+ tileName = tileName.substr(0, tileName.find_first_of('.'));
+ file = fopen(("meshes/" + tileName + ".cs").c_str(), "rb");
+
+ if(!file)
+ return false;
+
+ cs = rcAllocContourSet();
+
+ fread(&(cs->cs), sizeof(float), 1, file);
+ fread(&(cs->ch), sizeof(float), 1, file);
+ fread(cs->bmin, sizeof(float), 3, file);
+ fread(cs->bmax, sizeof(float), 3, file);
+ fread(&(cs->nconts), sizeof(int), 1, file);
+
+ if(cs->nconts)
+ cs->conts = new rcContour[cs->nconts];
+
+ for(int j = 0; j < cs->nconts; ++j)
+ {
+ cs->conts[j].verts = 0;
+ cs->conts[j].rverts = 0;
+
+ fread(&(cs->conts[j].area), sizeof(unsigned char), 1, file);
+ fread(&(cs->conts[j].reg), sizeof(unsigned short), 1, file);
+
+ fread(&(cs->conts[j].nverts), sizeof(int), 1, file);
+ cs->conts[j].verts = new int[cs->conts[j].nverts*4];
+ fread(cs->conts[j].verts, sizeof(int), cs->conts[j].nverts*4, file);
+
+ fread(&(cs->conts[j].nrverts), sizeof(int), 1, file);
+ cs->conts[j].rverts = new int[cs->conts[j].nrverts*4];
+ fread(cs->conts[j].rverts, sizeof(int), cs->conts[j].nrverts*4, file);
+ }
+
+ fclose(file);
+
+ return false;
+}
+
+int duReadPolyMesh(char* tile, rcPolyMesh* &mesh)
+{
+ FILE* file;
+
+ string tileName(tile);
+ tileName = tileName.substr(0, tileName.find_first_of('.'));
+ file = fopen(("meshes/" + tileName + ".pmesh").c_str(), "rb");
+
+ if(!file)
+ return false;
+
+ mesh = rcAllocPolyMesh();
+
+ fread(&(mesh->cs), sizeof(float), 1, file);
+ fread(&(mesh->ch), sizeof(float), 1, file);
+ fread(&(mesh->nvp), sizeof(int), 1, file);
+ fread(mesh->bmin, sizeof(float), 3, file);
+ fread(mesh->bmax, sizeof(float), 3, file);
+ fread(&(mesh->nverts), sizeof(int), 1, file);
+ mesh->verts = new unsigned short[mesh->nverts*3];
+ fread(mesh->verts, sizeof(unsigned short), mesh->nverts*3, file);
+ fread(&(mesh->npolys), sizeof(int), 1, file);
+ mesh->polys = new unsigned short[mesh->npolys*mesh->nvp*2];
+ mesh->flags = new unsigned short[mesh->npolys];
+ mesh->areas = new unsigned char[mesh->npolys];
+ mesh->regs = new unsigned short[mesh->npolys];
+ fread(mesh->polys, sizeof(unsigned short), mesh->npolys*mesh->nvp*2, file);
+ fread(mesh->flags, sizeof(unsigned short), mesh->npolys, file);
+ fread(mesh->areas, sizeof(unsigned char), mesh->npolys, file);
+ fread(mesh->regs, sizeof(unsigned short), mesh->npolys, file);
+
+ fclose(file);
+
+ return true;
+}
+
+int duReadDetailMesh(char* tile, rcPolyMeshDetail* &mesh)
+{
+ FILE* file;
+
+ string tileName(tile);
+ tileName = tileName.substr(0, tileName.find_first_of('.'));
+ file = fopen(("meshes/" + tileName + ".dmesh").c_str(), "rb");
+
+ if(!file)
+ return false;
+
+ mesh = rcAllocPolyMeshDetail();
+
+ fread(&(mesh->nverts), sizeof(int), 1, file);
+ mesh->verts = new float[mesh->nverts*3];
+ fread(mesh->verts, sizeof(float), mesh->nverts*3, file);
+
+ fread(&(mesh->ntris), sizeof(int), 1, file);
+ mesh->tris = new unsigned char[mesh->ntris*4];
+ fread(mesh->tris, sizeof(char), mesh->ntris*4, file);
+
+ fread(&(mesh->nmeshes), sizeof(int), 1, file);
+ mesh->meshes = new unsigned int[mesh->nmeshes*4];
+ fread(mesh->meshes, sizeof(int), mesh->nmeshes*4, file);
+
+ fclose(file);
+
+ return true;
+}
+
+myMeshLoaderObj::myMeshLoaderObj() :
+ m_verts(0),
+ m_tris(0),
+ m_normals(0),
+ m_vertCount(0),
+ m_triCount(0)
+{
+}
+
+myMeshLoaderObj::~myMeshLoaderObj()
+{
+ delete [] m_verts;
+ delete [] m_normals;
+ delete [] m_tris;
+}
+
+bool myMeshLoaderObj::load(const char* filename)
+{
+ FILE* file;
+
+ float* verts = 0;
+ int vertCount = 0;
+ int* tris = 0;
+ int triCount = 0;
+
+ if(!(file = fopen(filename, "rb")))
+ return false;
+
+ // read verts
+ fread(&vertCount, sizeof(int), 1, file);
+ verts = new float[vertCount*3];
+ fread(verts, sizeof(float), vertCount*3, file);
+
+ // read triangles
+ fread(&triCount, sizeof(int), 1, file);
+ tris = new int[triCount*3];
+ fread(tris, sizeof(int), triCount*3, file);
+
+ fclose(file);
+
+ m_verts = verts;
+ m_vertCount = vertCount;
+ m_tris = tris;
+ m_triCount = triCount;
+
+ m_normals = new float[m_triCount*3];
+ for (int i = 0; i < m_triCount*3; i += 3)
+ {
+ const float* v0 = &m_verts[m_tris[i]*3];
+ const float* v1 = &m_verts[m_tris[i+1]*3];
+ const float* v2 = &m_verts[m_tris[i+2]*3];
+ float e0[3], e1[3];
+ for (int j = 0; j < 3; ++j)
+ {
+ e0[j] = v1[j] - v0[j];
+ e1[j] = v2[j] - v0[j];
+ }
+ float* n = &m_normals[i];
+ n[0] = e0[1]*e1[2] - e0[2]*e1[1];
+ n[1] = e0[2]*e1[0] - e0[0]*e1[2];
+ n[2] = e0[0]*e1[1] - e0[1]*e1[0];
+ float d = sqrtf(n[0]*n[0] + n[1]*n[1] + n[2]*n[2]);
+ if (d > 0)
+ {
+ d = 1.0f/d;
+ n[0] *= d;
+ n[1] *= d;
+ n[2] *= d;
+ }
+ }
+
+ strncpy(m_filename, filename, sizeof(m_filename));
+ m_filename[sizeof(m_filename)-1] = '\0';
+
+ return true;
+}
diff --git a/dep/recastnavigation/RecastDemo/Source/Filelist.cpp b/dep/recastnavigation/RecastDemo/Source/Filelist.cpp
new file mode 100644
index 000000000..9df30345e
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/Filelist.cpp
@@ -0,0 +1,100 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#include "Filelist.h"
+#include
+#include
+#include
+#ifdef WIN32
+# include
+#else
+# include
+#endif
+
+static void fileListAdd(FileList& list, const char* path)
+{
+ if (list.size >= FileList::MAX_FILES)
+ return;
+ int n = strlen(path);
+ list.files[list.size] = new char[n+1];
+ strcpy(list.files[list.size], path);
+ list.size++;
+}
+
+static void fileListClear(FileList& list)
+{
+ for (int i = 0; i < list.size; ++i)
+ delete [] list.files[i];
+ list.size = 0;
+}
+
+FileList::FileList() : size(0)
+{
+ memset(files, 0, sizeof(char*)*MAX_FILES);
+}
+
+FileList::~FileList()
+{
+ fileListClear(*this);
+}
+
+static int cmp(const void* a, const void* b)
+{
+ return strcmp(*(const char**)a, *(const char**)b);
+}
+
+void scanDirectory(const char* path, const char* ext, FileList& list)
+{
+ fileListClear(list);
+
+#ifdef WIN32
+ _finddata_t dir;
+ char pathWithExt[260];
+ long fh;
+ strcpy(pathWithExt, path);
+ strcat(pathWithExt, "/*");
+ strcat(pathWithExt, ext);
+ fh = _findfirst(pathWithExt, &dir);
+ if (fh == -1L)
+ return;
+ do
+ {
+ fileListAdd(list, dir.name);
+ }
+ while (_findnext(fh, &dir) == 0);
+ _findclose(fh);
+#else
+ dirent* current = 0;
+ DIR* dp = opendir(path);
+ if (!dp)
+ return;
+
+ while ((current = readdir(dp)) != 0)
+ {
+ int len = strlen(current->d_name);
+ if (len > 4 && strncmp(current->d_name+len-4, ext, 4) == 0)
+ {
+ fileListAdd(list, current->d_name);
+ }
+ }
+ closedir(dp);
+#endif
+
+ if (list.size > 1)
+ qsort(list.files, list.size, sizeof(char*), cmp);
+}
diff --git a/dep/recastnavigation/RecastDemo/Source/InputGeom.cpp b/dep/recastnavigation/RecastDemo/Source/InputGeom.cpp
new file mode 100644
index 000000000..46ff657b6
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/InputGeom.cpp
@@ -0,0 +1,512 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#define _USE_MATH_DEFINES
+#include
+#include
+#include
+#include
+#include "Recast.h"
+#include "InputGeom.h"
+#include "ChunkyTriMesh.h"
+#include "MeshLoaderObj.h"
+#include "DebugDraw.h"
+#include "RecastDebugDraw.h"
+#include "DetourNavMesh.h"
+
+static bool intersectSegmentTriangle(const float* sp, const float* sq,
+ const float* a, const float* b, const float* c,
+ float &t)
+{
+ float v, w;
+ float ab[3], ac[3], qp[3], ap[3], norm[3], e[3];
+ rcVsub(ab, b, a);
+ rcVsub(ac, c, a);
+ rcVsub(qp, sp, sq);
+
+ // Compute triangle normal. Can be precalculated or cached if
+ // intersecting multiple segments against the same triangle
+ rcVcross(norm, ab, ac);
+
+ // Compute denominator d. If d <= 0, segment is parallel to or points
+ // away from triangle, so exit early
+ float d = rcVdot(qp, norm);
+ if (d <= 0.0f) return false;
+
+ // Compute intersection t value of pq with plane of triangle. A ray
+ // intersects iff 0 <= t. Segment intersects iff 0 <= t <= 1. Delay
+ // dividing by d until intersection has been found to pierce triangle
+ rcVsub(ap, sp, a);
+ t = rcVdot(ap, norm);
+ if (t < 0.0f) return false;
+ if (t > d) return false; // For segment; exclude this code line for a ray test
+
+ // Compute barycentric coordinate components and test if within bounds
+ rcVcross(e, qp, ap);
+ v = rcVdot(ac, e);
+ if (v < 0.0f || v > d) return false;
+ w = -rcVdot(ab, e);
+ if (w < 0.0f || v + w > d) return false;
+
+ // Segment/ray intersects triangle. Perform delayed division
+ t /= d;
+
+ return true;
+}
+
+static char* parseRow(char* buf, char* bufEnd, char* row, int len)
+{
+ bool start = true;
+ bool done = false;
+ int n = 0;
+ while (!done && buf < bufEnd)
+ {
+ char c = *buf;
+ buf++;
+ // multirow
+ switch (c)
+ {
+ case '\n':
+ if (start) break;
+ done = true;
+ break;
+ case '\r':
+ break;
+ case '\t':
+ case ' ':
+ if (start) break;
+ default:
+ start = false;
+ row[n++] = c;
+ if (n >= len-1)
+ done = true;
+ break;
+ }
+ }
+ row[n] = '\0';
+ return buf;
+}
+
+
+
+InputGeom::InputGeom() :
+ m_chunkyMesh(0),
+ m_mesh(0),
+ m_offMeshConCount(0),
+ m_volumeCount(0)
+{
+}
+
+InputGeom::~InputGeom()
+{
+ delete m_chunkyMesh;
+ delete m_mesh;
+}
+
+bool InputGeom::loadMesh(rcContext* ctx, const char* filepath)
+{
+ if (m_mesh)
+ {
+ delete m_chunkyMesh;
+ m_chunkyMesh = 0;
+ delete m_mesh;
+ m_mesh = 0;
+ }
+ m_offMeshConCount = 0;
+ m_volumeCount = 0;
+
+ m_mesh = new myMeshLoaderObj;
+ if (!m_mesh)
+ {
+ ctx->log(RC_LOG_ERROR, "loadMesh: Out of memory 'm_mesh'.");
+ return false;
+ }
+ if (!m_mesh->load(filepath))
+ {
+ ctx->log(RC_LOG_ERROR, "buildTiledNavigation: Could not load '%s'", filepath);
+ return false;
+ }
+
+ rcCalcBounds(m_mesh->getVerts(), m_mesh->getVertCount(), m_meshBMin, m_meshBMax);
+
+ m_chunkyMesh = new rcChunkyTriMesh;
+ if (!m_chunkyMesh)
+ {
+ ctx->log(RC_LOG_ERROR, "buildTiledNavigation: Out of memory 'm_chunkyMesh'.");
+ return false;
+ }
+ if (!rcCreateChunkyTriMesh(m_mesh->getVerts(), m_mesh->getTris(), m_mesh->getTriCount(), 256, m_chunkyMesh))
+ {
+ ctx->log(RC_LOG_ERROR, "buildTiledNavigation: Failed to build chunky mesh.");
+ return false;
+ }
+
+ return true;
+}
+
+bool InputGeom::load(rcContext* ctx, const char* filePath)
+{
+ char* buf = 0;
+ FILE* fp = fopen(filePath, "rb");
+ if (!fp)
+ return false;
+ fseek(fp, 0, SEEK_END);
+ int bufSize = ftell(fp);
+ fseek(fp, 0, SEEK_SET);
+ buf = new char[bufSize];
+ if (!buf)
+ {
+ fclose(fp);
+ return false;
+ }
+ fread(buf, bufSize, 1, fp);
+ fclose(fp);
+
+ m_offMeshConCount = 0;
+ m_volumeCount = 0;
+ delete m_mesh;
+ m_mesh = 0;
+
+ char* src = buf;
+ char* srcEnd = buf + bufSize;
+ char row[512];
+ while (src < srcEnd)
+ {
+ // Parse one row
+ row[0] = '\0';
+ src = parseRow(src, srcEnd, row, sizeof(row)/sizeof(char));
+ if (row[0] == 'f')
+ {
+ // File name.
+ const char* name = row+1;
+ // Skip white spaces
+ while (*name && isspace(*name))
+ name++;
+ if (*name)
+ {
+ if (!loadMesh(ctx, name))
+ {
+ delete [] buf;
+ return false;
+ }
+ }
+ }
+ else if (row[0] == 'c')
+ {
+ // Off-mesh connection
+ if (m_offMeshConCount < MAX_OFFMESH_CONNECTIONS)
+ {
+ float* v = &m_offMeshConVerts[m_offMeshConCount*3*2];
+ int bidir, area = 0, flags = 0;
+ float rad;
+ sscanf(row+1, "%f %f %f %f %f %f %f %d %d %d",
+ &v[0], &v[1], &v[2], &v[3], &v[4], &v[5], &rad, &bidir, &area, &flags);
+ m_offMeshConRads[m_offMeshConCount] = rad;
+ m_offMeshConDirs[m_offMeshConCount] = (unsigned char)bidir;
+ m_offMeshConAreas[m_offMeshConCount] = (unsigned char)area;
+ m_offMeshConFlags[m_offMeshConCount] = (unsigned short)flags;
+ m_offMeshConCount++;
+ }
+ }
+ else if (row[0] == 'v')
+ {
+ // Convex volumes
+ if (m_volumeCount < MAX_VOLUMES)
+ {
+ ConvexVolume* vol = &m_volumes[m_volumeCount++];
+ sscanf(row+1, "%d %d %f %f", &vol->nverts, &vol->area, &vol->hmin, &vol->hmax);
+ for (int i = 0; i < vol->nverts; ++i)
+ {
+ row[0] = '\0';
+ src = parseRow(src, srcEnd, row, sizeof(row)/sizeof(char));
+ sscanf(row, "%f %f %f", &vol->verts[i*3+0], &vol->verts[i*3+1], &vol->verts[i*3+2]);
+ }
+ }
+ }
+ }
+
+ delete [] buf;
+
+ return true;
+}
+
+bool InputGeom::save(const char* filepath)
+{
+ if (!m_mesh) return false;
+
+ FILE* fp = fopen(filepath, "w");
+ if (!fp) return false;
+
+ // Store mesh filename.
+ fprintf(fp, "f %s\n", m_mesh->getFileName());
+
+ // Store off-mesh links.
+ for (int i = 0; i < m_offMeshConCount; ++i)
+ {
+ const float* v = &m_offMeshConVerts[i*3*2];
+ const float rad = m_offMeshConRads[i];
+ const int bidir = m_offMeshConDirs[i];
+ const int area = m_offMeshConAreas[i];
+ const int flags = m_offMeshConFlags[i];
+ fprintf(fp, "c %f %f %f %f %f %f %f %d %d %d\n",
+ v[0], v[1], v[2], v[3], v[4], v[5], rad, bidir, area, flags);
+ }
+
+ // Convex volumes
+ for (int i = 0; i < m_volumeCount; ++i)
+ {
+ ConvexVolume* vol = &m_volumes[i];
+ fprintf(fp, "v %d %d %f %f\n", vol->nverts, vol->area, vol->hmin, vol->hmax);
+ for (int i = 0; i < vol->nverts; ++i)
+ fprintf(fp, "%f %f %f\n", vol->verts[i*3+0], vol->verts[i*3+1], vol->verts[i*3+2]);
+ }
+
+ fclose(fp);
+
+ return true;
+}
+
+static bool isectSegAABB(const float* sp, const float* sq,
+ const float* amin, const float* amax,
+ float& tmin, float& tmax)
+{
+ static const float EPS = 1e-6f;
+
+ float d[3];
+ d[0] = sq[0] - sp[0];
+ d[1] = sq[1] - sp[1];
+ d[2] = sq[2] - sp[2];
+ tmin = 0.0;
+ tmax = 1.0f;
+
+ for (int i = 0; i < 3; i++)
+ {
+ if (fabsf(d[i]) < EPS)
+ {
+ if (sp[i] < amin[i] || sp[i] > amax[i])
+ return false;
+ }
+ else
+ {
+ const float ood = 1.0f / d[i];
+ float t1 = (amin[i] - sp[i]) * ood;
+ float t2 = (amax[i] - sp[i]) * ood;
+ if (t1 > t2) { float tmp = t1; t1 = t2; t2 = tmp; }
+ if (t1 > tmin) tmin = t1;
+ if (t2 < tmax) tmax = t2;
+ if (tmin > tmax) return false;
+ }
+ }
+
+ return true;
+}
+
+
+bool InputGeom::raycastMesh(float* src, float* dst, float& tmin)
+{
+ float dir[3];
+ rcVsub(dir, dst, src);
+
+ // Prune hit ray.
+ float btmin, btmax;
+ if (!isectSegAABB(src, dst, m_meshBMin, m_meshBMax, btmin, btmax))
+ return false;
+ float p[2], q[2];
+ p[0] = src[0] + (dst[0]-src[0])*btmin;
+ p[1] = src[2] + (dst[2]-src[2])*btmin;
+ q[0] = src[0] + (dst[0]-src[0])*btmax;
+ q[1] = src[2] + (dst[2]-src[2])*btmax;
+
+ int cid[512];
+ const int ncid = rcGetChunksOverlappingSegment(m_chunkyMesh, p, q, cid, 512);
+ if (!ncid)
+ return false;
+
+ tmin = 1.0f;
+ bool hit = false;
+ const float* verts = m_mesh->getVerts();
+
+ for (int i = 0; i < ncid; ++i)
+ {
+ const rcChunkyTriMeshNode& node = m_chunkyMesh->nodes[cid[i]];
+ const int* tris = &m_chunkyMesh->tris[node.i*3];
+ const int ntris = node.n;
+
+ for (int j = 0; j < ntris*3; j += 3)
+ {
+ float t = 1;
+ if (intersectSegmentTriangle(src, dst,
+ &verts[tris[j]*3],
+ &verts[tris[j+1]*3],
+ &verts[tris[j+2]*3], t))
+ {
+ if (t < tmin)
+ tmin = t;
+ hit = true;
+ }
+ }
+ }
+
+ return hit;
+}
+
+void InputGeom::addOffMeshConnection(const float* spos, const float* epos, const float rad,
+ unsigned char bidir, unsigned char area, unsigned short flags)
+{
+ if (m_offMeshConCount >= MAX_OFFMESH_CONNECTIONS) return;
+ float* v = &m_offMeshConVerts[m_offMeshConCount*3*2];
+ m_offMeshConRads[m_offMeshConCount] = rad;
+ m_offMeshConDirs[m_offMeshConCount] = bidir;
+ m_offMeshConAreas[m_offMeshConCount] = area;
+ m_offMeshConFlags[m_offMeshConCount] = flags;
+ m_offMeshConId[m_offMeshConCount] = 1000 + m_offMeshConCount;
+ rcVcopy(&v[0], spos);
+ rcVcopy(&v[3], epos);
+ m_offMeshConCount++;
+}
+
+void InputGeom::deleteOffMeshConnection(int i)
+{
+ m_offMeshConCount--;
+ float* src = &m_offMeshConVerts[m_offMeshConCount*3*2];
+ float* dst = &m_offMeshConVerts[i*3*2];
+ rcVcopy(&dst[0], &src[0]);
+ rcVcopy(&dst[3], &src[3]);
+ m_offMeshConRads[i] = m_offMeshConRads[m_offMeshConCount];
+ m_offMeshConDirs[i] = m_offMeshConDirs[m_offMeshConCount];
+ m_offMeshConAreas[i] = m_offMeshConAreas[m_offMeshConCount];
+ m_offMeshConFlags[i] = m_offMeshConFlags[m_offMeshConCount];
+}
+
+void InputGeom::drawOffMeshConnections(duDebugDraw* dd, bool hilight)
+{
+ unsigned int conColor = duRGBA(192,0,128,192);
+ unsigned int baseColor = duRGBA(0,0,0,64);
+ dd->depthMask(false);
+
+ dd->begin(DU_DRAW_LINES, 2.0f);
+ for (int i = 0; i < m_offMeshConCount; ++i)
+ {
+ float* v = &m_offMeshConVerts[i*3*2];
+
+ dd->vertex(v[0],v[1],v[2], baseColor);
+ dd->vertex(v[0],v[1]+0.2f,v[2], baseColor);
+
+ dd->vertex(v[3],v[4],v[5], baseColor);
+ dd->vertex(v[3],v[4]+0.2f,v[5], baseColor);
+
+ duAppendCircle(dd, v[0],v[1]+0.1f,v[2], m_offMeshConRads[i], baseColor);
+ duAppendCircle(dd, v[3],v[4]+0.1f,v[5], m_offMeshConRads[i], baseColor);
+
+ if (hilight)
+ {
+ duAppendArc(dd, v[0],v[1],v[2], v[3],v[4],v[5], 0.25f,
+ (m_offMeshConDirs[i]&1) ? 0.6f : 0.0f, 0.6f, conColor);
+ }
+ }
+ dd->end();
+
+ dd->depthMask(true);
+}
+
+void InputGeom::addConvexVolume(const float* verts, const int nverts,
+ const float minh, const float maxh, unsigned char area)
+{
+ if (m_volumeCount >= MAX_VOLUMES) return;
+ ConvexVolume* vol = &m_volumes[m_volumeCount++];
+ memset(vol, 0, sizeof(ConvexVolume));
+ memcpy(vol->verts, verts, sizeof(float)*3*nverts);
+ vol->hmin = minh;
+ vol->hmax = maxh;
+ vol->nverts = nverts;
+ vol->area = area;
+}
+
+void InputGeom::deleteConvexVolume(int i)
+{
+ m_volumeCount--;
+ m_volumes[i] = m_volumes[m_volumeCount];
+}
+
+void InputGeom::drawConvexVolumes(struct duDebugDraw* dd, bool /*hilight*/)
+{
+ dd->depthMask(false);
+
+ dd->begin(DU_DRAW_TRIS);
+
+ for (int i = 0; i < m_volumeCount; ++i)
+ {
+ const ConvexVolume* vol = &m_volumes[i];
+ unsigned int col = duIntToCol(vol->area, 32);
+ for (int j = 0, k = vol->nverts-1; j < vol->nverts; k = j++)
+ {
+ const float* va = &vol->verts[k*3];
+ const float* vb = &vol->verts[j*3];
+
+ dd->vertex(vol->verts[0],vol->hmax,vol->verts[2], col);
+ dd->vertex(vb[0],vol->hmax,vb[2], col);
+ dd->vertex(va[0],vol->hmax,va[2], col);
+
+ dd->vertex(va[0],vol->hmin,va[2], duDarkenCol(col));
+ dd->vertex(va[0],vol->hmax,va[2], col);
+ dd->vertex(vb[0],vol->hmax,vb[2], col);
+
+ dd->vertex(va[0],vol->hmin,va[2], duDarkenCol(col));
+ dd->vertex(vb[0],vol->hmax,vb[2], col);
+ dd->vertex(vb[0],vol->hmin,vb[2], duDarkenCol(col));
+ }
+ }
+
+ dd->end();
+
+ dd->begin(DU_DRAW_LINES, 2.0f);
+ for (int i = 0; i < m_volumeCount; ++i)
+ {
+ const ConvexVolume* vol = &m_volumes[i];
+ unsigned int col = duIntToCol(vol->area, 220);
+ for (int j = 0, k = vol->nverts-1; j < vol->nverts; k = j++)
+ {
+ const float* va = &vol->verts[k*3];
+ const float* vb = &vol->verts[j*3];
+ dd->vertex(va[0],vol->hmin,va[2], duDarkenCol(col));
+ dd->vertex(vb[0],vol->hmin,vb[2], duDarkenCol(col));
+ dd->vertex(va[0],vol->hmax,va[2], col);
+ dd->vertex(vb[0],vol->hmax,vb[2], col);
+ dd->vertex(va[0],vol->hmin,va[2], duDarkenCol(col));
+ dd->vertex(va[0],vol->hmax,va[2], col);
+ }
+ }
+ dd->end();
+
+ dd->begin(DU_DRAW_POINTS, 3.0f);
+ for (int i = 0; i < m_volumeCount; ++i)
+ {
+ const ConvexVolume* vol = &m_volumes[i];
+ unsigned int col = duDarkenCol(duIntToCol(vol->area, 255));
+ for (int j = 0; j < vol->nverts; ++j)
+ {
+ dd->vertex(vol->verts[j*3+0],vol->verts[j*3+1]+0.1f,vol->verts[j*3+2], col);
+ dd->vertex(vol->verts[j*3+0],vol->hmin,vol->verts[j*3+2], col);
+ dd->vertex(vol->verts[j*3+0],vol->hmax,vol->verts[j*3+2], col);
+ }
+ }
+ dd->end();
+
+
+ dd->depthMask(true);
+}
diff --git a/dep/recastnavigation/RecastDemo/Source/MeshLoaderObj.cpp b/dep/recastnavigation/RecastDemo/Source/MeshLoaderObj.cpp
new file mode 100644
index 000000000..182822083
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/MeshLoaderObj.cpp
@@ -0,0 +1,229 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#include "MeshLoaderObj.h"
+#include
+#include
+#include
+#define _USE_MATH_DEFINES
+#include
+
+rcMeshLoaderObj::rcMeshLoaderObj() :
+ m_verts(0),
+ m_tris(0),
+ m_normals(0),
+ m_vertCount(0),
+ m_triCount(0)
+{
+}
+
+rcMeshLoaderObj::~rcMeshLoaderObj()
+{
+ delete [] m_verts;
+ delete [] m_normals;
+ delete [] m_tris;
+}
+
+void rcMeshLoaderObj::addVertex(float x, float y, float z, int& cap)
+{
+ if (m_vertCount+1 > cap)
+ {
+ cap = !cap ? 8 : cap*2;
+ float* nv = new float[cap*3];
+ if (m_vertCount)
+ memcpy(nv, m_verts, m_vertCount*3*sizeof(float));
+ delete [] m_verts;
+ m_verts = nv;
+ }
+ float* dst = &m_verts[m_vertCount*3];
+ *dst++ = x;
+ *dst++ = y;
+ *dst++ = z;
+ m_vertCount++;
+}
+
+void rcMeshLoaderObj::addTriangle(int a, int b, int c, int& cap)
+{
+ if (m_triCount+1 > cap)
+ {
+ cap = !cap ? 8 : cap*2;
+ int* nv = new int[cap*3];
+ if (m_triCount)
+ memcpy(nv, m_tris, m_triCount*3*sizeof(int));
+ delete [] m_tris;
+ m_tris = nv;
+ }
+ int* dst = &m_tris[m_triCount*3];
+ *dst++ = a;
+ *dst++ = b;
+ *dst++ = c;
+ m_triCount++;
+}
+
+static char* parseRow(char* buf, char* bufEnd, char* row, int len)
+{
+ bool cont = false;
+ bool start = true;
+ bool done = false;
+ int n = 0;
+ while (!done && buf < bufEnd)
+ {
+ char c = *buf;
+ buf++;
+ // multirow
+ switch (c)
+ {
+ case '\\':
+ cont = true; // multirow
+ break;
+ case '\n':
+ if (start) break;
+ done = true;
+ break;
+ case '\r':
+ break;
+ case '\t':
+ case ' ':
+ if (start) break;
+ default:
+ start = false;
+ cont = false;
+ row[n++] = c;
+ if (n >= len-1)
+ done = true;
+ break;
+ }
+ }
+ row[n] = '\0';
+ return buf;
+}
+
+static int parseFace(char* row, int* data, int n, int vcnt)
+{
+ int j = 0;
+ while (*row != '\0')
+ {
+ // Skip initial white space
+ while (*row != '\0' && (*row == ' ' || *row == '\t'))
+ row++;
+ char* s = row;
+ // Find vertex delimiter and terminated the string there for conversion.
+ while (*row != '\0' && *row != ' ' && *row != '\t')
+ {
+ if (*row == '/') *row = '\0';
+ row++;
+ }
+ if (*s == '\0')
+ continue;
+ int vi = atoi(s);
+ data[j++] = vi < 0 ? vi+vcnt : vi-1;
+ if (j >= n) return j;
+ }
+ return j;
+}
+
+bool rcMeshLoaderObj::load(const char* filename)
+{
+ char* buf = 0;
+ FILE* fp = fopen(filename, "rb");
+ if (!fp)
+ return false;
+ fseek(fp, 0, SEEK_END);
+ int bufSize = ftell(fp);
+ fseek(fp, 0, SEEK_SET);
+ buf = new char[bufSize];
+ if (!buf)
+ {
+ fclose(fp);
+ return false;
+ }
+ fread(buf, bufSize, 1, fp);
+ fclose(fp);
+
+ char* src = buf;
+ char* srcEnd = buf + bufSize;
+ char row[512];
+ int face[32];
+ float x,y,z;
+ int nv;
+ int vcap = 0;
+ int tcap = 0;
+
+ while (src < srcEnd)
+ {
+ // Parse one row
+ row[0] = '\0';
+ src = parseRow(src, srcEnd, row, sizeof(row)/sizeof(char));
+ // Skip comments
+ if (row[0] == '#') continue;
+ if (row[0] == 'v' && row[1] != 'n' && row[1] != 't')
+ {
+ // Vertex pos
+ sscanf(row+1, "%f %f %f", &x, &y, &z);
+ addVertex(x, y, z, vcap);
+ }
+ if (row[0] == 'f')
+ {
+ // Faces
+ nv = parseFace(row+1, face, 32, m_vertCount);
+ for (int i = 2; i < nv; ++i)
+ {
+ const int a = face[0];
+ const int b = face[i-1];
+ const int c = face[i];
+ if (a < 0 || a >= m_vertCount || b < 0 || b >= m_vertCount || c < 0 || c >= m_vertCount)
+ continue;
+ addTriangle(a, b, c, tcap);
+ }
+ }
+ }
+
+ delete [] buf;
+
+ // Calculate normals.
+ m_normals = new float[m_triCount*3];
+ for (int i = 0; i < m_triCount*3; i += 3)
+ {
+ const float* v0 = &m_verts[m_tris[i]*3];
+ const float* v1 = &m_verts[m_tris[i+1]*3];
+ const float* v2 = &m_verts[m_tris[i+2]*3];
+ float e0[3], e1[3];
+ for (int j = 0; j < 3; ++j)
+ {
+ e0[j] = v1[j] - v0[j];
+ e1[j] = v2[j] - v0[j];
+ }
+ float* n = &m_normals[i];
+ n[0] = e0[1]*e1[2] - e0[2]*e1[1];
+ n[1] = e0[2]*e1[0] - e0[0]*e1[2];
+ n[2] = e0[0]*e1[1] - e0[1]*e1[0];
+ float d = sqrtf(n[0]*n[0] + n[1]*n[1] + n[2]*n[2]);
+ if (d > 0)
+ {
+ d = 1.0f/d;
+ n[0] *= d;
+ n[1] *= d;
+ n[2] *= d;
+ }
+ }
+
+ strncpy(m_filename, filename, sizeof(m_filename));
+ m_filename[sizeof(m_filename)-1] = '\0';
+
+ return true;
+}
diff --git a/dep/recastnavigation/RecastDemo/Source/NavMeshTesterTool.cpp b/dep/recastnavigation/RecastDemo/Source/NavMeshTesterTool.cpp
new file mode 100644
index 000000000..38b06e4a3
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/NavMeshTesterTool.cpp
@@ -0,0 +1,1216 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#define _USE_MATH_DEFINES
+#include
+#include
+#include
+#include "SDL.h"
+#include "SDL_opengl.h"
+#include "imgui.h"
+#include "NavMeshTesterTool.h"
+#include "Sample.h"
+#include "Recast.h"
+#include "RecastDebugDraw.h"
+#include "DetourNavMesh.h"
+#include "DetourNavMeshBuilder.h"
+#include "DetourDebugDraw.h"
+#include "DetourCommon.h"
+
+#ifdef WIN32
+# define snprintf _snprintf
+#endif
+
+// Uncomment this to dump all the requests in stdout.
+#define DUMP_REQS
+
+inline bool inRange(const float* v1, const float* v2, const float r, const float h)
+{
+ const float dx = v2[0] - v1[0];
+ const float dy = v2[1] - v1[1];
+ const float dz = v2[2] - v1[2];
+ return (dx*dx + dz*dz) < r*r && fabsf(dy) < h;
+}
+
+
+static int fixupCorridor(dtPolyRef* path, const int npath, const int maxPath,
+ const dtPolyRef* visited, const int nvisited)
+{
+ int furthestPath = -1;
+ int furthestVisited = -1;
+
+ // Find furthest common polygon.
+ for (int i = npath-1; i >= 0; --i)
+ {
+ bool found = false;
+ for (int j = nvisited-1; j >= 0; --j)
+ {
+ if (path[i] == visited[j])
+ {
+ furthestPath = i;
+ furthestVisited = j;
+ found = true;
+ }
+ }
+ if (found)
+ break;
+ }
+
+ // If no intersection found just return current path.
+ if (furthestPath == -1 || furthestVisited == -1)
+ return npath;
+
+ // Concatenate paths.
+
+ // Adjust beginning of the buffer to include the visited.
+ const int req = nvisited - furthestVisited;
+ const int orig = rcMin(furthestPath+1, npath);
+ int size = rcMax(0, npath-orig);
+ if (req+size > maxPath)
+ size = maxPath-req;
+ if (size)
+ memmove(path+req, path+orig, size*sizeof(dtPolyRef));
+
+ // Store visited
+ for (int i = 0; i < req; ++i)
+ path[i] = visited[(nvisited-1)-i];
+
+ return req+size;
+}
+
+static bool getSteerTarget(dtNavMeshQuery* navQuery, const float* startPos, const float* endPos,
+ const float minTargetDist,
+ const dtPolyRef* path, const int pathSize,
+ float* steerPos, unsigned char& steerPosFlag, dtPolyRef& steerPosRef,
+ float* outPoints = 0, int* outPointCount = 0)
+{
+ // Find steer target.
+ static const int MAX_STEER_POINTS = 3;
+ float steerPath[MAX_STEER_POINTS*3];
+ unsigned char steerPathFlags[MAX_STEER_POINTS];
+ dtPolyRef steerPathPolys[MAX_STEER_POINTS];
+ int nsteerPath = 0;
+ navQuery->findStraightPath(startPos, endPos, path, pathSize,
+ steerPath, steerPathFlags, steerPathPolys, &nsteerPath, MAX_STEER_POINTS);
+ if (!nsteerPath)
+ return false;
+
+ if (outPoints && outPointCount)
+ {
+ *outPointCount = nsteerPath;
+ for (int i = 0; i < nsteerPath; ++i)
+ dtVcopy(&outPoints[i*3], &steerPath[i*3]);
+ }
+
+
+ // Find vertex far enough to steer to.
+ int ns = 0;
+ while (ns < nsteerPath)
+ {
+ // Stop at Off-Mesh link or when point is further than slop away.
+ if ((steerPathFlags[ns] & DT_STRAIGHTPATH_OFFMESH_CONNECTION) ||
+ !inRange(&steerPath[ns*3], startPos, minTargetDist, 1000.0f))
+ break;
+ ns++;
+ }
+ // Failed to find good point to steer to.
+ if (ns >= nsteerPath)
+ return false;
+
+ dtVcopy(steerPos, &steerPath[ns*3]);
+ steerPos[1] = startPos[1];
+ steerPosFlag = steerPathFlags[ns];
+ steerPosRef = steerPathPolys[ns];
+
+ return true;
+}
+
+
+NavMeshTesterTool::NavMeshTesterTool() :
+ m_sample(0),
+ m_navMesh(0),
+ m_navQuery(0),
+ m_pathFindStatus(DT_FAILURE),
+ m_toolMode(TOOLMODE_PATHFIND_FOLLOW),
+ m_startRef(0),
+ m_endRef(0),
+ m_npolys(0),
+ m_nstraightPath(0),
+ m_nsmoothPath(0),
+ m_hitResult(false),
+ m_distanceToWall(0),
+ m_sposSet(false),
+ m_eposSet(false),
+ m_pathIterNum(0),
+ m_steerPointCount(0)
+{
+ m_filter.setIncludeFlags(SAMPLE_POLYFLAGS_ALL);
+ m_filter.setExcludeFlags(0);
+
+ m_polyPickExt[0] = 2;
+ m_polyPickExt[1] = 4;
+ m_polyPickExt[2] = 2;
+
+ m_neighbourhoodRadius = 2.5f;
+}
+
+NavMeshTesterTool::~NavMeshTesterTool()
+{
+}
+
+void NavMeshTesterTool::init(Sample* sample)
+{
+ m_sample = sample;
+ m_navMesh = sample->getNavMesh();
+ m_navQuery = sample->getNavMeshQuery();
+ recalc();
+
+ if (m_navQuery)
+ {
+ // Change costs.
+ m_filter.setAreaCost(SAMPLE_POLYAREA_GROUND, 1.0f);
+ m_filter.setAreaCost(SAMPLE_POLYAREA_WATER, 10.0f);
+ m_filter.setAreaCost(SAMPLE_POLYAREA_ROAD, 1.0f);
+ m_filter.setAreaCost(SAMPLE_POLYAREA_DOOR, 1.0f);
+ m_filter.setAreaCost(SAMPLE_POLYAREA_GRASS, 2.0f);
+ m_filter.setAreaCost(SAMPLE_POLYAREA_JUMP, 1.5f);
+ }
+
+ m_neighbourhoodRadius = sample->getAgentRadius() * 20.0f;
+}
+
+void NavMeshTesterTool::handleMenu()
+{
+ if (imguiCheck("Pathfind Follow", m_toolMode == TOOLMODE_PATHFIND_FOLLOW))
+ {
+ m_toolMode = TOOLMODE_PATHFIND_FOLLOW;
+ recalc();
+ }
+ if (imguiCheck("Pathfind Straight", m_toolMode == TOOLMODE_PATHFIND_STRAIGHT))
+ {
+ m_toolMode = TOOLMODE_PATHFIND_STRAIGHT;
+ recalc();
+ }
+ if (imguiCheck("Pathfind Sliced", m_toolMode == TOOLMODE_PATHFIND_SLICED))
+ {
+ m_toolMode = TOOLMODE_PATHFIND_SLICED;
+ recalc();
+ }
+
+ imguiSeparator();
+
+ if (imguiCheck("Distance to Wall", m_toolMode == TOOLMODE_DISTANCE_TO_WALL))
+ {
+ m_toolMode = TOOLMODE_DISTANCE_TO_WALL;
+ recalc();
+ }
+
+ imguiSeparator();
+
+ if (imguiCheck("Raycast", m_toolMode == TOOLMODE_RAYCAST))
+ {
+ m_toolMode = TOOLMODE_RAYCAST;
+ recalc();
+ }
+
+ imguiSeparator();
+
+ if (imguiCheck("Find Polys in Circle", m_toolMode == TOOLMODE_FIND_POLYS_IN_CIRCLE))
+ {
+ m_toolMode = TOOLMODE_FIND_POLYS_IN_CIRCLE;
+ recalc();
+ }
+ if (imguiCheck("Find Polys in Shape", m_toolMode == TOOLMODE_FIND_POLYS_IN_SHAPE))
+ {
+ m_toolMode = TOOLMODE_FIND_POLYS_IN_SHAPE;
+ recalc();
+ }
+
+ imguiSeparator();
+
+ if (imguiCheck("Find Local Neighbourhood", m_toolMode == TOOLMODE_FIND_LOCAL_NEIGHBOURHOOD))
+ {
+ m_toolMode = TOOLMODE_FIND_LOCAL_NEIGHBOURHOOD;
+ recalc();
+ }
+
+ imguiSeparator();
+
+ imguiLabel("Include Flags");
+
+ imguiIndent();
+ if (imguiCheck("Walk", (m_filter.getIncludeFlags() & SAMPLE_POLYFLAGS_WALK) != 0))
+ {
+ m_filter.setIncludeFlags(m_filter.getIncludeFlags() ^ SAMPLE_POLYFLAGS_WALK);
+ recalc();
+ }
+ if (imguiCheck("Swim", (m_filter.getIncludeFlags() & SAMPLE_POLYFLAGS_SWIM) != 0))
+ {
+ m_filter.setIncludeFlags(m_filter.getIncludeFlags() ^ SAMPLE_POLYFLAGS_SWIM);
+ recalc();
+ }
+ if (imguiCheck("Door", (m_filter.getIncludeFlags() & SAMPLE_POLYFLAGS_DOOR) != 0))
+ {
+ m_filter.setIncludeFlags(m_filter.getIncludeFlags() ^ SAMPLE_POLYFLAGS_DOOR);
+ recalc();
+ }
+ if (imguiCheck("Jump", (m_filter.getIncludeFlags() & SAMPLE_POLYFLAGS_JUMP) != 0))
+ {
+ m_filter.setIncludeFlags(m_filter.getIncludeFlags() ^ SAMPLE_POLYFLAGS_JUMP);
+ recalc();
+ }
+ imguiUnindent();
+
+ imguiSeparator();
+ imguiLabel("Exclude Flags");
+
+ imguiIndent();
+ if (imguiCheck("Walk", (m_filter.getExcludeFlags() & SAMPLE_POLYFLAGS_WALK) != 0))
+ {
+ m_filter.setExcludeFlags(m_filter.getExcludeFlags() ^ SAMPLE_POLYFLAGS_WALK);
+ recalc();
+ }
+ if (imguiCheck("Swim", (m_filter.getExcludeFlags() & SAMPLE_POLYFLAGS_SWIM) != 0))
+ {
+ m_filter.setExcludeFlags(m_filter.getExcludeFlags() ^ SAMPLE_POLYFLAGS_SWIM);
+ recalc();
+ }
+ if (imguiCheck("Door", (m_filter.getExcludeFlags() & SAMPLE_POLYFLAGS_DOOR) != 0))
+ {
+ m_filter.setExcludeFlags(m_filter.getExcludeFlags() ^ SAMPLE_POLYFLAGS_DOOR);
+ recalc();
+ }
+ if (imguiCheck("Jump", (m_filter.getExcludeFlags() & SAMPLE_POLYFLAGS_JUMP) != 0))
+ {
+ m_filter.setExcludeFlags(m_filter.getExcludeFlags() ^ SAMPLE_POLYFLAGS_JUMP);
+ recalc();
+ }
+ imguiUnindent();
+
+ imguiSeparator();
+}
+
+void NavMeshTesterTool::handleClick(const float* /*s*/, const float* p, bool shift)
+{
+ if (shift)
+ {
+ m_sposSet = true;
+ dtVcopy(m_spos, p);
+ }
+ else
+ {
+ m_eposSet = true;
+ dtVcopy(m_epos, p);
+ }
+ recalc();
+}
+
+void NavMeshTesterTool::handleStep()
+{
+}
+
+void NavMeshTesterTool::handleToggle()
+{
+ // TODO: merge separate to a path iterator. Use same code in recalc() too.
+ if (m_toolMode != TOOLMODE_PATHFIND_FOLLOW)
+ return;
+
+ if (!m_sposSet || !m_eposSet || !m_startRef || !m_endRef)
+ return;
+
+ static const float STEP_SIZE = 0.5f;
+ static const float SLOP = 0.01f;
+
+ if (m_pathIterNum == 0)
+ {
+ m_navQuery->findPath(m_startRef, m_endRef, m_spos, m_epos, &m_filter, m_polys, &m_npolys, MAX_POLYS);
+ m_nsmoothPath = 0;
+
+ m_pathIterPolyCount = m_npolys;
+ if (m_pathIterPolyCount)
+ memcpy(m_pathIterPolys, m_polys, sizeof(dtPolyRef)*m_pathIterPolyCount);
+
+ if (m_pathIterPolyCount)
+ {
+ // Iterate over the path to find smooth path on the detail mesh surface.
+
+ m_navQuery->closestPointOnPolyBoundary(m_startRef, m_spos, m_iterPos);
+ m_navQuery->closestPointOnPolyBoundary(m_pathIterPolys[m_pathIterPolyCount-1], m_epos, m_targetPos);
+
+ m_nsmoothPath = 0;
+
+ dtVcopy(&m_smoothPath[m_nsmoothPath*3], m_iterPos);
+ m_nsmoothPath++;
+ }
+ }
+
+ dtVcopy(m_prevIterPos, m_iterPos);
+
+ m_pathIterNum++;
+
+ if (!m_pathIterPolyCount)
+ return;
+
+ if (m_nsmoothPath >= MAX_SMOOTH)
+ return;
+
+ // Move towards target a small advancement at a time until target reached or
+ // when ran out of memory to store the path.
+
+ // Find location to steer towards.
+ float steerPos[3];
+ unsigned char steerPosFlag;
+ dtPolyRef steerPosRef;
+
+ if (!getSteerTarget(m_navQuery, m_iterPos, m_targetPos, SLOP,
+ m_pathIterPolys, m_pathIterPolyCount, steerPos, steerPosFlag, steerPosRef,
+ m_steerPoints, &m_steerPointCount))
+ return;
+
+ dtVcopy(m_steerPos, steerPos);
+
+ bool endOfPath = (steerPosFlag & DT_STRAIGHTPATH_END) ? true : false;
+ bool offMeshConnection = (steerPosFlag & DT_STRAIGHTPATH_OFFMESH_CONNECTION) ? true : false;
+
+ // Find movement delta.
+ float delta[3], len;
+ dtVsub(delta, steerPos, m_iterPos);
+ len = sqrtf(dtVdot(delta,delta));
+ // If the steer target is end of path or off-mesh link, do not move past the location.
+ if ((endOfPath || offMeshConnection) && len < STEP_SIZE)
+ len = 1;
+ else
+ len = STEP_SIZE / len;
+ float moveTgt[3];
+ dtVmad(moveTgt, m_iterPos, delta, len);
+
+ // Move
+ float result[3];
+ dtPolyRef visited[16];
+ int nvisited = 0;
+ m_navQuery->moveAlongSurface(m_pathIterPolys[0], m_iterPos, moveTgt, &m_filter,
+ result, visited, &nvisited, 16);
+ m_pathIterPolyCount = fixupCorridor(m_pathIterPolys, m_pathIterPolyCount, MAX_POLYS, visited, nvisited);
+ float h = 0;
+ m_navQuery->getPolyHeight(m_pathIterPolys[0], result, &h);
+ result[1] = h;
+ dtVcopy(m_iterPos, result);
+
+ // Handle end of path and off-mesh links when close enough.
+ if (endOfPath && inRange(m_iterPos, steerPos, SLOP, 1.0f))
+ {
+ // Reached end of path.
+ dtVcopy(m_iterPos, m_targetPos);
+ if (m_nsmoothPath < MAX_SMOOTH)
+ {
+ dtVcopy(&m_smoothPath[m_nsmoothPath*3], m_iterPos);
+ m_nsmoothPath++;
+ }
+ return;
+ }
+ else if (offMeshConnection && inRange(m_iterPos, steerPos, SLOP, 1.0f))
+ {
+ // Reached off-mesh connection.
+ float startPos[3], endPos[3];
+
+ // Advance the path up to and over the off-mesh connection.
+ dtPolyRef prevRef = 0, polyRef = m_pathIterPolys[0];
+ int npos = 0;
+ while (npos < m_pathIterPolyCount && polyRef != steerPosRef)
+ {
+ prevRef = polyRef;
+ polyRef = m_pathIterPolys[npos];
+ npos++;
+ }
+ for (int i = npos; i < m_pathIterPolyCount; ++i)
+ m_pathIterPolys[i-npos] = m_pathIterPolys[i];
+ m_pathIterPolyCount -= npos;
+
+ // Handle the connection.
+ if (m_navMesh->getOffMeshConnectionPolyEndPoints(prevRef, polyRef, startPos, endPos) == DT_SUCCESS)
+ {
+ if (m_nsmoothPath < MAX_SMOOTH)
+ {
+ dtVcopy(&m_smoothPath[m_nsmoothPath*3], startPos);
+ m_nsmoothPath++;
+ // Hack to make the dotted path not visible during off-mesh connection.
+ if (m_nsmoothPath & 1)
+ {
+ dtVcopy(&m_smoothPath[m_nsmoothPath*3], startPos);
+ m_nsmoothPath++;
+ }
+ }
+ // Move position at the other side of the off-mesh link.
+ dtVcopy(m_iterPos, endPos);
+ float h;
+ m_navQuery->getPolyHeight(m_pathIterPolys[0], m_iterPos, &h);
+ m_iterPos[1] = h;
+ }
+ }
+
+ // Store results.
+ if (m_nsmoothPath < MAX_SMOOTH)
+ {
+ dtVcopy(&m_smoothPath[m_nsmoothPath*3], m_iterPos);
+ m_nsmoothPath++;
+ }
+
+}
+
+void NavMeshTesterTool::handleUpdate(const float /*dt*/)
+{
+ if (m_toolMode == TOOLMODE_PATHFIND_SLICED)
+ {
+ if (m_pathFindStatus == DT_IN_PROGRESS)
+ {
+ m_pathFindStatus = m_navQuery->updateSlicedFindPath(1);
+ }
+
+ if (m_pathFindStatus == DT_SUCCESS)
+ {
+ m_navQuery->finalizeSlicedFindPath(m_polys, &m_npolys, MAX_POLYS);
+ m_nstraightPath = 0;
+ if (m_npolys)
+ {
+ // In case of partial path, make sure the end point is clamped to the last polygon.
+ float epos[3];
+ dtVcopy(epos, m_epos);
+ if (m_polys[m_npolys-1] != m_endRef)
+ m_navQuery->closestPointOnPoly(m_polys[m_npolys-1], m_epos, epos);
+
+ m_navQuery->findStraightPath(m_spos, epos, m_polys, m_npolys,
+ m_straightPath, m_straightPathFlags,
+ m_straightPathPolys, &m_nstraightPath, MAX_POLYS);
+ }
+
+ m_pathFindStatus = DT_FAILURE;
+ }
+ }
+}
+
+void NavMeshTesterTool::reset()
+{
+ m_startRef = 0;
+ m_endRef = 0;
+ m_npolys = 0;
+ m_nstraightPath = 0;
+ m_nsmoothPath = 0;
+ memset(m_hitPos, 0, sizeof(m_hitPos));
+ memset(m_hitNormal, 0, sizeof(m_hitNormal));
+ m_distanceToWall = 0;
+}
+
+
+void NavMeshTesterTool::recalc()
+{
+ if (!m_navMesh)
+ return;
+
+ if (m_sposSet)
+ m_navQuery->findNearestPoly(m_spos, m_polyPickExt, &m_filter, &m_startRef, 0);
+ else
+ m_startRef = 0;
+
+ if (m_eposSet)
+ m_navQuery->findNearestPoly(m_epos, m_polyPickExt, &m_filter, &m_endRef, 0);
+ else
+ m_endRef = 0;
+
+ m_pathFindStatus = DT_FAILURE;
+
+ if (m_toolMode == TOOLMODE_PATHFIND_FOLLOW)
+ {
+ m_pathIterNum = 0;
+ if (m_sposSet && m_eposSet && m_startRef && m_endRef)
+ {
+#ifdef DUMP_REQS
+ printf("pi %f %f %f %f %f %f 0x%x 0x%x\n",
+ m_spos[0],m_spos[1],m_spos[2], m_epos[0],m_epos[1],m_epos[2],
+ m_filter.getIncludeFlags(), m_filter.getExcludeFlags());
+#endif
+
+ m_navQuery->findPath(m_startRef, m_endRef, m_spos, m_epos, &m_filter, m_polys, &m_npolys, MAX_POLYS);
+
+ m_nsmoothPath = 0;
+
+ if (m_npolys)
+ {
+ // Iterate over the path to find smooth path on the detail mesh surface.
+ dtPolyRef polys[MAX_POLYS];
+ memcpy(polys, m_polys, sizeof(dtPolyRef)*m_npolys);
+ int npolys = m_npolys;
+
+ float iterPos[3], targetPos[3];
+ m_navQuery->closestPointOnPolyBoundary(m_startRef, m_spos, iterPos);
+ m_navQuery->closestPointOnPolyBoundary(polys[npolys-1], m_epos, targetPos);
+
+ static const float STEP_SIZE = 0.5f;
+ static const float SLOP = 0.01f;
+
+ m_nsmoothPath = 0;
+
+ dtVcopy(&m_smoothPath[m_nsmoothPath*3], iterPos);
+ m_nsmoothPath++;
+
+ // Move towards target a small advancement at a time until target reached or
+ // when ran out of memory to store the path.
+ while (npolys && m_nsmoothPath < MAX_SMOOTH)
+ {
+ // Find location to steer towards.
+ float steerPos[3];
+ unsigned char steerPosFlag;
+ dtPolyRef steerPosRef;
+
+ if (!getSteerTarget(m_navQuery, iterPos, targetPos, SLOP,
+ polys, npolys, steerPos, steerPosFlag, steerPosRef))
+ break;
+
+ bool endOfPath = (steerPosFlag & DT_STRAIGHTPATH_END) ? true : false;
+ bool offMeshConnection = (steerPosFlag & DT_STRAIGHTPATH_OFFMESH_CONNECTION) ? true : false;
+
+ // Find movement delta.
+ float delta[3], len;
+ dtVsub(delta, steerPos, iterPos);
+ len = dtSqrt(dtVdot(delta,delta));
+ // If the steer target is end of path or off-mesh link, do not move past the location.
+ if ((endOfPath || offMeshConnection) && len < STEP_SIZE)
+ len = 1;
+ else
+ len = STEP_SIZE / len;
+ float moveTgt[3];
+ dtVmad(moveTgt, iterPos, delta, len);
+
+ // Move
+ float result[3];
+ dtPolyRef visited[16];
+ int nvisited = 0;
+ m_navQuery->moveAlongSurface(polys[0], iterPos, moveTgt, &m_filter,
+ result, visited, &nvisited, 16);
+
+ npolys = fixupCorridor(polys, npolys, MAX_POLYS, visited, nvisited);
+ float h = 0;
+ m_navQuery->getPolyHeight(polys[0], result, &h);
+ result[1] = h;
+ dtVcopy(iterPos, result);
+
+ // Handle end of path and off-mesh links when close enough.
+ if (endOfPath && inRange(iterPos, steerPos, SLOP, 1.0f))
+ {
+ // Reached end of path.
+ dtVcopy(iterPos, targetPos);
+ if (m_nsmoothPath < MAX_SMOOTH)
+ {
+ dtVcopy(&m_smoothPath[m_nsmoothPath*3], iterPos);
+ m_nsmoothPath++;
+ }
+ break;
+ }
+ else if (offMeshConnection && inRange(iterPos, steerPos, SLOP, 1.0f))
+ {
+ // Reached off-mesh connection.
+ float startPos[3], endPos[3];
+
+ // Advance the path up to and over the off-mesh connection.
+ dtPolyRef prevRef = 0, polyRef = polys[0];
+ int npos = 0;
+ while (npos < npolys && polyRef != steerPosRef)
+ {
+ prevRef = polyRef;
+ polyRef = polys[npos];
+ npos++;
+ }
+ for (int i = npos; i < npolys; ++i)
+ polys[i-npos] = polys[i];
+ npolys -= npos;
+
+ // Handle the connection.
+ if (m_navMesh->getOffMeshConnectionPolyEndPoints(prevRef, polyRef, startPos, endPos) == DT_SUCCESS)
+ {
+ if (m_nsmoothPath < MAX_SMOOTH)
+ {
+ dtVcopy(&m_smoothPath[m_nsmoothPath*3], startPos);
+ m_nsmoothPath++;
+ // Hack to make the dotted path not visible during off-mesh connection.
+ if (m_nsmoothPath & 1)
+ {
+ dtVcopy(&m_smoothPath[m_nsmoothPath*3], startPos);
+ m_nsmoothPath++;
+ }
+ }
+ // Move position at the other side of the off-mesh link.
+ dtVcopy(iterPos, endPos);
+ float h;
+ m_navQuery->getPolyHeight(polys[0], iterPos, &h);
+ iterPos[1] = h;
+ }
+ }
+
+ // Store results.
+ if (m_nsmoothPath < MAX_SMOOTH)
+ {
+ dtVcopy(&m_smoothPath[m_nsmoothPath*3], iterPos);
+ m_nsmoothPath++;
+ }
+ }
+ }
+
+ }
+ else
+ {
+ m_npolys = 0;
+ m_nsmoothPath = 0;
+ }
+ }
+ else if (m_toolMode == TOOLMODE_PATHFIND_STRAIGHT)
+ {
+ if (m_sposSet && m_eposSet && m_startRef && m_endRef)
+ {
+#ifdef DUMP_REQS
+ printf("ps %f %f %f %f %f %f 0x%x 0x%x\n",
+ m_spos[0],m_spos[1],m_spos[2], m_epos[0],m_epos[1],m_epos[2],
+ m_filter.getIncludeFlags(), m_filter.getExcludeFlags());
+#endif
+ m_navQuery->findPath(m_startRef, m_endRef, m_spos, m_epos, &m_filter, m_polys, &m_npolys, MAX_POLYS);
+ m_nstraightPath = 0;
+ if (m_npolys)
+ {
+ // In case of partial path, make sure the end point is clamped to the last polygon.
+ float epos[3];
+ dtVcopy(epos, m_epos);
+ if (m_polys[m_npolys-1] != m_endRef)
+ m_navQuery->closestPointOnPoly(m_polys[m_npolys-1], m_epos, epos);
+
+ m_navQuery->findStraightPath(m_spos, epos, m_polys, m_npolys,
+ m_straightPath, m_straightPathFlags,
+ m_straightPathPolys, &m_nstraightPath, MAX_POLYS);
+ }
+ }
+ else
+ {
+ m_npolys = 0;
+ m_nstraightPath = 0;
+ }
+ }
+ else if (m_toolMode == TOOLMODE_PATHFIND_SLICED)
+ {
+ if (m_sposSet && m_eposSet && m_startRef && m_endRef)
+ {
+#ifdef DUMP_REQS
+ printf("ps %f %f %f %f %f %f 0x%x 0x%x\n",
+ m_spos[0],m_spos[1],m_spos[2], m_epos[0],m_epos[1],m_epos[2],
+ m_filter.getIncludeFlags(), m_filter.getExcludeFlags());
+#endif
+ m_npolys = 0;
+ m_nstraightPath = 0;
+
+ m_pathFindStatus = m_navQuery->initSlicedFindPath(m_startRef, m_endRef, m_spos, m_epos, &m_filter);
+ }
+ else
+ {
+ m_npolys = 0;
+ m_nstraightPath = 0;
+ }
+ }
+ else if (m_toolMode == TOOLMODE_RAYCAST)
+ {
+ m_nstraightPath = 0;
+ if (m_sposSet && m_eposSet && m_startRef)
+ {
+#ifdef DUMP_REQS
+ printf("rc %f %f %f %f %f %f 0x%x 0x%x\n",
+ m_spos[0],m_spos[1],m_spos[2], m_epos[0],m_epos[1],m_epos[2],
+ m_filter.getIncludeFlags(), m_filter.getExcludeFlags());
+#endif
+ float t = 0;
+ m_npolys = 0;
+ m_nstraightPath = 2;
+ m_straightPath[0] = m_spos[0];
+ m_straightPath[1] = m_spos[1];
+ m_straightPath[2] = m_spos[2];
+ m_navQuery->raycast(m_startRef, m_spos, m_epos, &m_filter, &t, m_hitNormal, m_polys, &m_npolys, MAX_POLYS);
+ if (t > 1)
+ {
+ // No hit
+ dtVcopy(m_hitPos, m_epos);
+ m_hitResult = false;
+ }
+ else
+ {
+ // Hit
+ m_hitPos[0] = m_spos[0] + (m_epos[0] - m_spos[0]) * t;
+ m_hitPos[1] = m_spos[1] + (m_epos[1] - m_spos[1]) * t;
+ m_hitPos[2] = m_spos[2] + (m_epos[2] - m_spos[2]) * t;
+ if (m_npolys)
+ {
+ float h = 0;
+ m_navQuery->getPolyHeight(m_polys[m_npolys-1], m_hitPos, &h);
+ m_hitPos[1] = h;
+ }
+ m_hitResult = true;
+ }
+ dtVcopy(&m_straightPath[3], m_hitPos);
+ }
+ }
+ else if (m_toolMode == TOOLMODE_DISTANCE_TO_WALL)
+ {
+ m_distanceToWall = 0;
+ if (m_sposSet && m_startRef)
+ {
+#ifdef DUMP_REQS
+ printf("dw %f %f %f %f 0x%x 0x%x\n",
+ m_spos[0],m_spos[1],m_spos[2], 100.0f,
+ m_filter.getIncludeFlags(), m_filter.getExcludeFlags());
+#endif
+ m_distanceToWall = 0.0f;
+ m_navQuery->findDistanceToWall(m_startRef, m_spos, 100.0f, &m_filter, &m_distanceToWall, m_hitPos, m_hitNormal);
+ }
+ }
+ else if (m_toolMode == TOOLMODE_FIND_POLYS_IN_CIRCLE)
+ {
+ if (m_sposSet && m_startRef && m_eposSet)
+ {
+ const float dx = m_epos[0] - m_spos[0];
+ const float dz = m_epos[2] - m_spos[2];
+ float dist = sqrtf(dx*dx + dz*dz);
+#ifdef DUMP_REQS
+ printf("fpc %f %f %f %f 0x%x 0x%x\n",
+ m_spos[0],m_spos[1],m_spos[2], dist,
+ m_filter.getIncludeFlags(), m_filter.getExcludeFlags());
+#endif
+ m_navQuery->findPolysAroundCircle(m_startRef, m_spos, dist, &m_filter,
+ m_polys, m_parent, 0, &m_npolys, MAX_POLYS);
+
+ }
+ }
+ else if (m_toolMode == TOOLMODE_FIND_POLYS_IN_SHAPE)
+ {
+ if (m_sposSet && m_startRef && m_eposSet)
+ {
+ const float nx = (m_epos[2] - m_spos[2])*0.25f;
+ const float nz = -(m_epos[0] - m_spos[0])*0.25f;
+ const float agentHeight = m_sample ? m_sample->getAgentHeight() : 0;
+
+ m_queryPoly[0] = m_spos[0] + nx*1.2f;
+ m_queryPoly[1] = m_spos[1] + agentHeight/2;
+ m_queryPoly[2] = m_spos[2] + nz*1.2f;
+
+ m_queryPoly[3] = m_spos[0] - nx*1.3f;
+ m_queryPoly[4] = m_spos[1] + agentHeight/2;
+ m_queryPoly[5] = m_spos[2] - nz*1.3f;
+
+ m_queryPoly[6] = m_epos[0] - nx*0.8f;
+ m_queryPoly[7] = m_epos[1] + agentHeight/2;
+ m_queryPoly[8] = m_epos[2] - nz*0.8f;
+
+ m_queryPoly[9] = m_epos[0] + nx;
+ m_queryPoly[10] = m_epos[1] + agentHeight/2;
+ m_queryPoly[11] = m_epos[2] + nz;
+
+#ifdef DUMP_REQS
+ printf("fpp %f %f %f %f %f %f %f %f %f %f %f %f 0x%x 0x%x\n",
+ m_queryPoly[0],m_queryPoly[1],m_queryPoly[2],
+ m_queryPoly[3],m_queryPoly[4],m_queryPoly[5],
+ m_queryPoly[6],m_queryPoly[7],m_queryPoly[8],
+ m_queryPoly[9],m_queryPoly[10],m_queryPoly[11],
+ m_filter.getIncludeFlags(), m_filter.getExcludeFlags());
+#endif
+ m_navQuery->findPolysAroundShape(m_startRef, m_queryPoly, 4, &m_filter,
+ m_polys, m_parent, 0, &m_npolys, MAX_POLYS);
+ }
+ }
+ else if (m_toolMode == TOOLMODE_FIND_LOCAL_NEIGHBOURHOOD)
+ {
+ if (m_sposSet && m_startRef)
+ {
+#ifdef DUMP_REQS
+ printf("fln %f %f %f %f 0x%x 0x%x\n",
+ m_spos[0],m_spos[1],m_spos[2], m_neighbourhoodRadius,
+ m_filter.getIncludeFlags(), m_filter.getExcludeFlags());
+#endif
+ m_navQuery->findLocalNeighbourhood(m_startRef, m_spos, m_neighbourhoodRadius, &m_filter,
+ m_polys, m_parent, &m_npolys, MAX_POLYS);
+ }
+ }
+}
+
+static void getPolyCenter(dtNavMesh* navMesh, dtPolyRef ref, float* center)
+{
+ center[0] = 0;
+ center[1] = 0;
+ center[2] = 0;
+
+ const dtMeshTile* tile = 0;
+ const dtPoly* poly = 0;
+ if (navMesh->getTileAndPolyByRef(ref, &tile, &poly) != DT_SUCCESS)
+ return;
+
+ for (int i = 0; i < (int)poly->vertCount; ++i)
+ {
+ const float* v = &tile->verts[poly->verts[i]*3];
+ center[0] += v[0];
+ center[1] += v[1];
+ center[2] += v[2];
+ }
+ const float s = 1.0f / poly->vertCount;
+ center[0] *= s;
+ center[1] *= s;
+ center[2] *= s;
+}
+
+
+
+void NavMeshTesterTool::handleRender()
+{
+ DebugDrawGL dd;
+
+ static const unsigned int startCol = duRGBA(128,25,0,192);
+ static const unsigned int endCol = duRGBA(51,102,0,129);
+ static const unsigned int pathCol = duRGBA(0,0,0,64);
+
+ const float agentRadius = m_sample->getAgentRadius();
+ const float agentHeight = m_sample->getAgentHeight();
+ const float agentClimb = m_sample->getAgentClimb();
+
+ dd.depthMask(false);
+ if (m_sposSet)
+ drawAgent(m_spos, agentRadius, agentHeight, agentClimb, startCol);
+ if (m_eposSet)
+ drawAgent(m_epos, agentRadius, agentHeight, agentClimb, endCol);
+ dd.depthMask(true);
+
+ if (!m_navMesh)
+ {
+ return;
+ }
+
+ if (m_toolMode == TOOLMODE_PATHFIND_FOLLOW)
+ {
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_startRef, startCol);
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_endRef, endCol);
+
+ if (m_npolys)
+ {
+ for (int i = 1; i < m_npolys-1; ++i)
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_polys[i], pathCol);
+ }
+
+ if (m_nsmoothPath)
+ {
+ dd.depthMask(false);
+ const unsigned int pathCol = duRGBA(0,0,0,220);
+ dd.begin(DU_DRAW_LINES, 3.0f);
+ for (int i = 0; i < m_nsmoothPath; ++i)
+ dd.vertex(m_smoothPath[i*3], m_smoothPath[i*3+1]+0.1f, m_smoothPath[i*3+2], pathCol);
+ dd.end();
+ dd.depthMask(true);
+ }
+
+ if (m_pathIterNum)
+ {
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_pathIterPolys[0], duRGBA(255,255,255,128));
+
+ dd.depthMask(false);
+ dd.begin(DU_DRAW_LINES, 1.0f);
+
+ const unsigned int prevCol = duRGBA(255,192,0,220);
+ const unsigned int curCol = duRGBA(255,255,255,220);
+ const unsigned int steerCol = duRGBA(0,192,255,220);
+
+ dd.vertex(m_prevIterPos[0],m_prevIterPos[1]-0.3f,m_prevIterPos[2], prevCol);
+ dd.vertex(m_prevIterPos[0],m_prevIterPos[1]+0.3f,m_prevIterPos[2], prevCol);
+
+ dd.vertex(m_iterPos[0],m_iterPos[1]-0.3f,m_iterPos[2], curCol);
+ dd.vertex(m_iterPos[0],m_iterPos[1]+0.3f,m_iterPos[2], curCol);
+
+ dd.vertex(m_prevIterPos[0],m_prevIterPos[1]+0.3f,m_prevIterPos[2], prevCol);
+ dd.vertex(m_iterPos[0],m_iterPos[1]+0.3f,m_iterPos[2], prevCol);
+
+ dd.vertex(m_prevIterPos[0],m_prevIterPos[1]+0.3f,m_prevIterPos[2], steerCol);
+ dd.vertex(m_steerPos[0],m_steerPos[1]+0.3f,m_steerPos[2], steerCol);
+
+ for (int i = 0; i < m_steerPointCount-1; ++i)
+ {
+ dd.vertex(m_steerPoints[i*3+0],m_steerPoints[i*3+1]+0.2f,m_steerPoints[i*3+2], duDarkenCol(steerCol));
+ dd.vertex(m_steerPoints[(i+1)*3+0],m_steerPoints[(i+1)*3+1]+0.2f,m_steerPoints[(i+1)*3+2], duDarkenCol(steerCol));
+ }
+
+ dd.end();
+ dd.depthMask(true);
+ }
+ }
+ else if (m_toolMode == TOOLMODE_PATHFIND_STRAIGHT || m_toolMode == TOOLMODE_PATHFIND_SLICED)
+ {
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_startRef, startCol);
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_endRef, endCol);
+
+ if (m_npolys)
+ {
+ for (int i = 1; i < m_npolys-1; ++i)
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_polys[i], pathCol);
+ }
+
+ if (m_nstraightPath)
+ {
+ dd.depthMask(false);
+ const unsigned int pathCol = duRGBA(64,16,0,220);
+ const unsigned int offMeshCol = duRGBA(128,96,0,220);
+ dd.begin(DU_DRAW_LINES, 2.0f);
+ for (int i = 0; i < m_nstraightPath-1; ++i)
+ {
+ unsigned int col = 0;
+ if (m_straightPathFlags[i] & DT_STRAIGHTPATH_OFFMESH_CONNECTION)
+ col = offMeshCol;
+ else
+ col = pathCol;
+
+ dd.vertex(m_straightPath[i*3], m_straightPath[i*3+1]+0.4f, m_straightPath[i*3+2], col);
+ dd.vertex(m_straightPath[(i+1)*3], m_straightPath[(i+1)*3+1]+0.4f, m_straightPath[(i+1)*3+2], col);
+ }
+ dd.end();
+ dd.begin(DU_DRAW_POINTS, 6.0f);
+ for (int i = 0; i < m_nstraightPath; ++i)
+ {
+ unsigned int col = 0;
+ if (m_straightPathFlags[i] & DT_STRAIGHTPATH_START)
+ col = startCol;
+ else if (m_straightPathFlags[i] & DT_STRAIGHTPATH_START)
+ col = endCol;
+ else if (m_straightPathFlags[i] & DT_STRAIGHTPATH_OFFMESH_CONNECTION)
+ col = offMeshCol;
+ else
+ col = pathCol;
+ dd.vertex(m_straightPath[i*3], m_straightPath[i*3+1]+0.4f, m_straightPath[i*3+2], pathCol);
+ }
+ dd.end();
+ dd.depthMask(true);
+ }
+ }
+ else if (m_toolMode == TOOLMODE_RAYCAST)
+ {
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_startRef, startCol);
+
+ if (m_nstraightPath)
+ {
+ for (int i = 1; i < m_npolys; ++i)
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_polys[i], pathCol);
+
+ dd.depthMask(false);
+ const unsigned int pathCol = m_hitResult ? duRGBA(64,16,0,220) : duRGBA(240,240,240,220);
+ dd.begin(DU_DRAW_LINES, 2.0f);
+ for (int i = 0; i < m_nstraightPath-1; ++i)
+ {
+ dd.vertex(m_straightPath[i*3], m_straightPath[i*3+1]+0.4f, m_straightPath[i*3+2], pathCol);
+ dd.vertex(m_straightPath[(i+1)*3], m_straightPath[(i+1)*3+1]+0.4f, m_straightPath[(i+1)*3+2], pathCol);
+ }
+ dd.end();
+ dd.begin(DU_DRAW_POINTS, 4.0f);
+ for (int i = 0; i < m_nstraightPath; ++i)
+ dd.vertex(m_straightPath[i*3], m_straightPath[i*3+1]+0.4f, m_straightPath[i*3+2], pathCol);
+ dd.end();
+
+ if (m_hitResult)
+ {
+ const unsigned int hitCol = duRGBA(0,0,0,128);
+ dd.begin(DU_DRAW_LINES, 2.0f);
+ dd.vertex(m_hitPos[0], m_hitPos[1] + 0.4f, m_hitPos[2], hitCol);
+ dd.vertex(m_hitPos[0] + m_hitNormal[0]*agentRadius,
+ m_hitPos[1] + 0.4f + m_hitNormal[1]*agentRadius,
+ m_hitPos[2] + m_hitNormal[2]*agentRadius, hitCol);
+ dd.end();
+ }
+ dd.depthMask(true);
+ }
+ }
+ else if (m_toolMode == TOOLMODE_DISTANCE_TO_WALL)
+ {
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_startRef, startCol);
+ dd.depthMask(false);
+ duDebugDrawCircle(&dd, m_spos[0], m_spos[1]+agentHeight/2, m_spos[2], m_distanceToWall, duRGBA(64,16,0,220), 2.0f);
+ dd.begin(DU_DRAW_LINES, 3.0f);
+ dd.vertex(m_hitPos[0], m_hitPos[1] + 0.02f, m_hitPos[2], duRGBA(0,0,0,192));
+ dd.vertex(m_hitPos[0], m_hitPos[1] + agentHeight, m_hitPos[2], duRGBA(0,0,0,192));
+ dd.end();
+ dd.depthMask(true);
+ }
+ else if (m_toolMode == TOOLMODE_FIND_POLYS_IN_CIRCLE)
+ {
+ for (int i = 0; i < m_npolys; ++i)
+ {
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_polys[i], pathCol);
+ dd.depthMask(false);
+ if (m_parent[i])
+ {
+ float p0[3], p1[3];
+ dd.depthMask(false);
+ getPolyCenter(m_navMesh, m_parent[i], p0);
+ getPolyCenter(m_navMesh, m_polys[i], p1);
+ duDebugDrawArc(&dd, p0[0],p0[1],p0[2], p1[0],p1[1],p1[2], 0.25f, 0.0f, 0.4f, duRGBA(0,0,0,128), 2.0f);
+ dd.depthMask(true);
+ }
+ dd.depthMask(true);
+ }
+
+ if (m_sposSet && m_eposSet)
+ {
+ dd.depthMask(false);
+ const float dx = m_epos[0] - m_spos[0];
+ const float dz = m_epos[2] - m_spos[2];
+ const float dist = sqrtf(dx*dx + dz*dz);
+ duDebugDrawCircle(&dd, m_spos[0], m_spos[1]+agentHeight/2, m_spos[2], dist, duRGBA(64,16,0,220), 2.0f);
+ dd.depthMask(true);
+ }
+ }
+ else if (m_toolMode == TOOLMODE_FIND_POLYS_IN_SHAPE)
+ {
+ for (int i = 0; i < m_npolys; ++i)
+ {
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_polys[i], pathCol);
+ dd.depthMask(false);
+ if (m_parent[i])
+ {
+ float p0[3], p1[3];
+ dd.depthMask(false);
+ getPolyCenter(m_navMesh, m_parent[i], p0);
+ getPolyCenter(m_navMesh, m_polys[i], p1);
+ duDebugDrawArc(&dd, p0[0],p0[1],p0[2], p1[0],p1[1],p1[2], 0.25f, 0.0f, 0.4f, duRGBA(0,0,0,128), 2.0f);
+ dd.depthMask(true);
+ }
+ dd.depthMask(true);
+ }
+
+ if (m_sposSet && m_eposSet)
+ {
+ dd.depthMask(false);
+ const unsigned int col = duRGBA(64,16,0,220);
+ dd.begin(DU_DRAW_LINES, 2.0f);
+ for (int i = 0, j = 3; i < 4; j=i++)
+ {
+ const float* p0 = &m_queryPoly[j*3];
+ const float* p1 = &m_queryPoly[i*3];
+ dd.vertex(p0, col);
+ dd.vertex(p1, col);
+ }
+ dd.end();
+ dd.depthMask(true);
+ }
+ }
+ else if (m_toolMode == TOOLMODE_FIND_LOCAL_NEIGHBOURHOOD)
+ {
+ for (int i = 0; i < m_npolys; ++i)
+ {
+ duDebugDrawNavMeshPoly(&dd, *m_navMesh, m_polys[i], pathCol);
+ dd.depthMask(false);
+ if (m_parent[i])
+ {
+ float p0[3], p1[3];
+ dd.depthMask(false);
+ getPolyCenter(m_navMesh, m_parent[i], p0);
+ getPolyCenter(m_navMesh, m_polys[i], p1);
+ duDebugDrawArc(&dd, p0[0],p0[1],p0[2], p1[0],p1[1],p1[2], 0.25f, 0.0f, 0.4f, duRGBA(0,0,0,128), 2.0f);
+ dd.depthMask(true);
+ }
+
+ static const int MAX_SEGS = DT_VERTS_PER_POLYGON*2;
+ float segs[MAX_SEGS*6];
+ int nsegs = 0;
+ m_navQuery->getPolyWallSegments(m_polys[i], &m_filter, segs, &nsegs, MAX_SEGS);
+ dd.begin(DU_DRAW_LINES, 2.0f);
+ for (int j = 0; j < nsegs; ++j)
+ {
+ const float* s = &segs[j*6];
+
+ // Skip too distant segments.
+ float tseg;
+ float distSqr = dtDistancePtSegSqr2D(m_spos, s, s+3, tseg);
+ if (distSqr > dtSqr(m_neighbourhoodRadius))
+ continue;
+
+ float delta[3], norm[3], p0[3], p1[3];
+ dtVsub(delta, s+3,s);
+ dtVmad(p0, s, delta, 0.5f);
+ norm[0] = delta[2];
+ norm[1] = 0;
+ norm[2] = -delta[0];
+ dtVnormalize(norm);
+ dtVmad(p1, p0, norm, agentRadius*0.5f);
+
+ // Skip backfacing segments.
+ unsigned int col = duRGBA(255,255,255,192);
+ if (dtTriArea2D(m_spos, s, s+3) < 0.0f)
+ col = duRGBA(255,255,255,64);
+
+ dd.vertex(p0[0],p0[1]+agentClimb,p0[2],duRGBA(0,0,0,128));
+ dd.vertex(p1[0],p1[1]+agentClimb,p1[2],duRGBA(0,0,0,128));
+
+ dd.vertex(s[0],s[1]+agentClimb,s[2],col);
+ dd.vertex(s[3],s[4]+agentClimb,s[5],col);
+ }
+ dd.end();
+
+ dd.depthMask(true);
+ }
+
+ if (m_sposSet)
+ {
+ dd.depthMask(false);
+ duDebugDrawCircle(&dd, m_spos[0], m_spos[1]+agentHeight/2, m_spos[2], m_neighbourhoodRadius, duRGBA(64,16,0,220), 2.0f);
+ dd.depthMask(true);
+ }
+ }
+}
+
+void NavMeshTesterTool::handleRenderOverlay(double* proj, double* model, int* view)
+{
+ GLdouble x, y, z;
+
+ // Draw start and end point labels
+ if (m_sposSet && gluProject((GLdouble)m_spos[0], (GLdouble)m_spos[1], (GLdouble)m_spos[2],
+ model, proj, view, &x, &y, &z))
+ {
+ imguiDrawText((int)x, (int)(y-25), IMGUI_ALIGN_CENTER, "Start", imguiRGBA(0,0,0,220));
+ }
+ if (m_eposSet && gluProject((GLdouble)m_epos[0], (GLdouble)m_epos[1], (GLdouble)m_epos[2],
+ model, proj, view, &x, &y, &z))
+ {
+ imguiDrawText((int)x, (int)(y-25), IMGUI_ALIGN_CENTER, "End", imguiRGBA(0,0,0,220));
+ }
+}
+
+void NavMeshTesterTool::drawAgent(const float* pos, float r, float h, float c, const unsigned int col)
+{
+ DebugDrawGL dd;
+
+ dd.depthMask(false);
+
+ // Agent dimensions.
+ duDebugDrawCylinderWire(&dd, pos[0]-r, pos[1]+0.02f, pos[2]-r, pos[0]+r, pos[1]+h, pos[2]+r, col, 2.0f);
+
+ duDebugDrawCircle(&dd, pos[0],pos[1]+c,pos[2],r,duRGBA(0,0,0,64),1.0f);
+
+ unsigned int colb = duRGBA(0,0,0,196);
+ dd.begin(DU_DRAW_LINES);
+ dd.vertex(pos[0], pos[1]-c, pos[2], colb);
+ dd.vertex(pos[0], pos[1]+c, pos[2], colb);
+ dd.vertex(pos[0]-r/2, pos[1]+0.02f, pos[2], colb);
+ dd.vertex(pos[0]+r/2, pos[1]+0.02f, pos[2], colb);
+ dd.vertex(pos[0], pos[1]+0.02f, pos[2]-r/2, colb);
+ dd.vertex(pos[0], pos[1]+0.02f, pos[2]+r/2, colb);
+ dd.end();
+
+ dd.depthMask(true);
+}
diff --git a/dep/recastnavigation/RecastDemo/Source/OffMeshConnectionTool.cpp b/dep/recastnavigation/RecastDemo/Source/OffMeshConnectionTool.cpp
new file mode 100644
index 000000000..ec192a603
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/OffMeshConnectionTool.cpp
@@ -0,0 +1,170 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#define _USE_MATH_DEFINES
+#include
+#include
+#include
+#include
+#include "SDL.h"
+#include "SDL_opengl.h"
+#include "imgui.h"
+#include "OffMeshConnectionTool.h"
+#include "InputGeom.h"
+#include "Sample.h"
+#include "Recast.h"
+#include "RecastDebugDraw.h"
+#include "DetourDebugDraw.h"
+
+#ifdef WIN32
+# define snprintf _snprintf
+#endif
+
+OffMeshConnectionTool::OffMeshConnectionTool() :
+ m_sample(0),
+ m_hitPosSet(0),
+ m_bidir(true),
+ m_oldFlags(0)
+{
+}
+
+OffMeshConnectionTool::~OffMeshConnectionTool()
+{
+ if (m_sample)
+ {
+ m_sample->setNavMeshDrawFlags(m_oldFlags);
+ }
+}
+
+void OffMeshConnectionTool::init(Sample* sample)
+{
+ if (m_sample != sample)
+ {
+ m_sample = sample;
+ m_oldFlags = m_sample->getNavMeshDrawFlags();
+ m_sample->setNavMeshDrawFlags(m_oldFlags & ~DU_DRAWNAVMESH_OFFMESHCONS);
+ }
+}
+
+void OffMeshConnectionTool::reset()
+{
+ m_hitPosSet = false;
+}
+
+void OffMeshConnectionTool::handleMenu()
+{
+ if (imguiCheck("One Way", !m_bidir))
+ m_bidir = false;
+ if (imguiCheck("Bidirectional", m_bidir))
+ m_bidir = true;
+
+ if (!m_hitPosSet)
+ {
+ imguiValue("Click to set connection start.");
+ }
+ else
+ {
+ imguiValue("Click to set connection end.");
+ }
+}
+
+void OffMeshConnectionTool::handleClick(const float* /*s*/, const float* p, bool shift)
+{
+ if (!m_sample) return;
+ InputGeom* geom = m_sample->getInputGeom();
+ if (!geom) return;
+
+ if (shift)
+ {
+ // Delete
+ // Find nearest link end-point
+ float nearestDist = FLT_MAX;
+ int nearestIndex = -1;
+ const float* verts = geom->getOffMeshConnectionVerts();
+ for (int i = 0; i < geom->getOffMeshConnectionCount()*2; ++i)
+ {
+ const float* v = &verts[i*3];
+ float d = rcVdistSqr(p, v);
+ if (d < nearestDist)
+ {
+ nearestDist = d;
+ nearestIndex = i/2; // Each link has two vertices.
+ }
+ }
+ // If end point close enough, delete it.
+ if (nearestIndex != -1 &&
+ sqrtf(nearestDist) < m_sample->getAgentRadius())
+ {
+ geom->deleteOffMeshConnection(nearestIndex);
+ }
+ }
+ else
+ {
+ // Create
+ if (!m_hitPosSet)
+ {
+ rcVcopy(m_hitPos, p);
+ m_hitPosSet = true;
+ }
+ else
+ {
+ const unsigned char area = SAMPLE_POLYAREA_JUMP;
+ const unsigned short flags = SAMPLE_POLYFLAGS_JUMP;
+ geom->addOffMeshConnection(m_hitPos, p, m_sample->getAgentRadius(), m_bidir ? 1 : 0, area, flags);
+ m_hitPosSet = false;
+ }
+ }
+
+}
+
+void OffMeshConnectionTool::handleToggle()
+{
+}
+
+void OffMeshConnectionTool::handleStep()
+{
+}
+
+void OffMeshConnectionTool::handleUpdate(const float /*dt*/)
+{
+}
+
+void OffMeshConnectionTool::handleRender()
+{
+ DebugDrawGL dd;
+ const float s = m_sample->getAgentRadius();
+
+ if (m_hitPosSet)
+ duDebugDrawCross(&dd, m_hitPos[0],m_hitPos[1]+0.1f,m_hitPos[2], s, duRGBA(0,0,0,128), 2.0f);
+
+ InputGeom* geom = m_sample->getInputGeom();
+ if (geom)
+ geom->drawOffMeshConnections(&dd, true);
+}
+
+void OffMeshConnectionTool::handleRenderOverlay(double* proj, double* model, int* view)
+{
+ GLdouble x, y, z;
+
+ // Draw start and end point labels
+ if (m_hitPosSet && gluProject((GLdouble)m_hitPos[0], (GLdouble)m_hitPos[1], (GLdouble)m_hitPos[2],
+ model, proj, view, &x, &y, &z))
+ {
+ imguiDrawText((int)x, (int)(y-25), IMGUI_ALIGN_CENTER, "Start", imguiRGBA(0,0,0,220));
+ }
+}
diff --git a/dep/recastnavigation/RecastDemo/Source/PerfTimer.cpp b/dep/recastnavigation/RecastDemo/Source/PerfTimer.cpp
new file mode 100644
index 000000000..32c08968e
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/PerfTimer.cpp
@@ -0,0 +1,60 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#include "PerfTimer.h"
+
+#if defined(WIN32)
+
+// Win32
+#include
+
+TimeVal getPerfTime()
+{
+ __int64 count;
+ QueryPerformanceCounter((LARGE_INTEGER*)&count);
+ return count;
+}
+
+int getPerfDeltaTimeUsec(const TimeVal start, const TimeVal end)
+{
+ static __int64 freq = 0;
+ if (freq == 0)
+ QueryPerformanceFrequency((LARGE_INTEGER*)&freq);
+ __int64 elapsed = end - start;
+ return (int)(elapsed*1000000 / freq);
+}
+
+#else
+
+// Linux, BSD, OSX
+
+#include
+
+TimeVal getPerfTime()
+{
+ timeval now;
+ gettimeofday(&now, 0);
+ return (TimeVal)now.tv_sec*1000000L + (TimeVal)now.tv_usec;
+}
+
+int getPerfDeltaTimeUsec(const TimeVal start, const TimeVal end)
+{
+ return (int)(end - start);
+}
+
+#endif
diff --git a/dep/recastnavigation/RecastDemo/Source/SDLMain.m b/dep/recastnavigation/RecastDemo/Source/SDLMain.m
new file mode 100644
index 000000000..2eaa1c11e
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/SDLMain.m
@@ -0,0 +1,384 @@
+/* SDLMain.m - main entry point for our Cocoa-ized SDL app
+ Initial Version: Darrell Walisser
+ Non-NIB-Code & other changes: Max Horn
+
+ Feel free to customize this file to suit your needs
+*/
+
+#import "SDL.h"
+#import "SDLMain.h"
+#import /* for MAXPATHLEN */
+#import
+
+/* For some reaon, Apple removed setAppleMenu from the headers in 10.4,
+ but the method still is there and works. To avoid warnings, we declare
+ it ourselves here. */
+@interface NSApplication(SDL_Missing_Methods)
+- (void)setAppleMenu:(NSMenu *)menu;
+@end
+
+/* Use this flag to determine whether we use SDLMain.nib or not */
+#define SDL_USE_NIB_FILE 0
+
+/* Use this flag to determine whether we use CPS (docking) or not */
+#define SDL_USE_CPS 1
+#ifdef SDL_USE_CPS
+/* Portions of CPS.h */
+typedef struct CPSProcessSerNum
+{
+ UInt32 lo;
+ UInt32 hi;
+} CPSProcessSerNum;
+
+extern OSErr CPSGetCurrentProcess( CPSProcessSerNum *psn);
+extern OSErr CPSEnableForegroundOperation( CPSProcessSerNum *psn, UInt32 _arg2, UInt32 _arg3, UInt32 _arg4, UInt32 _arg5);
+extern OSErr CPSSetFrontProcess( CPSProcessSerNum *psn);
+
+#endif /* SDL_USE_CPS */
+
+static int gArgc;
+static char **gArgv;
+static BOOL gFinderLaunch;
+static BOOL gCalledAppMainline = FALSE;
+
+static NSString *getApplicationName(void)
+{
+ NSDictionary *dict;
+ NSString *appName = 0;
+
+ /* Determine the application name */
+ dict = (NSDictionary *)CFBundleGetInfoDictionary(CFBundleGetMainBundle());
+ if (dict)
+ appName = [dict objectForKey: @"CFBundleName"];
+
+ if (![appName length])
+ appName = [[NSProcessInfo processInfo] processName];
+
+ return appName;
+}
+
+#if SDL_USE_NIB_FILE
+/* A helper category for NSString */
+@interface NSString (ReplaceSubString)
+- (NSString *)stringByReplacingRange:(NSRange)aRange with:(NSString *)aString;
+@end
+#endif
+
+@interface SDLApplication : NSApplication
+@end
+
+@implementation SDLApplication
+/* Invoked from the Quit menu item */
+- (void)terminate:(id)sender
+{
+ /* Post a SDL_QUIT event */
+ SDL_Event event;
+ event.type = SDL_QUIT;
+ SDL_PushEvent(&event);
+}
+@end
+
+/* The main class of the application, the application's delegate */
+@implementation SDLMain
+
+/* Set the working directory to the .app's parent directory */
+- (void) setupWorkingDirectory:(BOOL)shouldChdir
+{
+ if (shouldChdir)
+ {
+ char parentdir[MAXPATHLEN];
+ CFURLRef url = CFBundleCopyBundleURL(CFBundleGetMainBundle());
+ CFURLRef url2 = CFURLCreateCopyDeletingLastPathComponent(0, url);
+ if (CFURLGetFileSystemRepresentation(url2, true, (UInt8 *)parentdir, MAXPATHLEN)) {
+ assert ( chdir (parentdir) == 0 ); /* chdir to the binary app's parent */
+ }
+ CFRelease(url);
+ CFRelease(url2);
+ }
+
+}
+
+#if SDL_USE_NIB_FILE
+
+/* Fix menu to contain the real app name instead of "SDL App" */
+- (void)fixMenu:(NSMenu *)aMenu withAppName:(NSString *)appName
+{
+ NSRange aRange;
+ NSEnumerator *enumerator;
+ NSMenuItem *menuItem;
+
+ aRange = [[aMenu title] rangeOfString:@"SDL App"];
+ if (aRange.length != 0)
+ [aMenu setTitle: [[aMenu title] stringByReplacingRange:aRange with:appName]];
+
+ enumerator = [[aMenu itemArray] objectEnumerator];
+ while ((menuItem = [enumerator nextObject]))
+ {
+ aRange = [[menuItem title] rangeOfString:@"SDL App"];
+ if (aRange.length != 0)
+ [menuItem setTitle: [[menuItem title] stringByReplacingRange:aRange with:appName]];
+ if ([menuItem hasSubmenu])
+ [self fixMenu:[menuItem submenu] withAppName:appName];
+ }
+ [ aMenu sizeToFit ];
+}
+
+#else
+
+static void setApplicationMenu(void)
+{
+ /* warning: this code is very odd */
+ NSMenu *appleMenu;
+ NSMenuItem *menuItem;
+ NSString *title;
+ NSString *appName;
+
+ appName = getApplicationName();
+ appleMenu = [[NSMenu alloc] initWithTitle:@""];
+
+ /* Add menu items */
+ title = [@"About " stringByAppendingString:appName];
+ [appleMenu addItemWithTitle:title action:@selector(orderFrontStandardAboutPanel:) keyEquivalent:@""];
+
+ [appleMenu addItem:[NSMenuItem separatorItem]];
+
+ title = [@"Hide " stringByAppendingString:appName];
+ [appleMenu addItemWithTitle:title action:@selector(hide:) keyEquivalent:@"h"];
+
+ menuItem = (NSMenuItem *)[appleMenu addItemWithTitle:@"Hide Others" action:@selector(hideOtherApplications:) keyEquivalent:@"h"];
+ [menuItem setKeyEquivalentModifierMask:(NSAlternateKeyMask|NSCommandKeyMask)];
+
+ [appleMenu addItemWithTitle:@"Show All" action:@selector(unhideAllApplications:) keyEquivalent:@""];
+
+ [appleMenu addItem:[NSMenuItem separatorItem]];
+
+ title = [@"Quit " stringByAppendingString:appName];
+ [appleMenu addItemWithTitle:title action:@selector(terminate:) keyEquivalent:@"q"];
+
+
+ /* Put menu into the menubar */
+ menuItem = [[NSMenuItem alloc] initWithTitle:@"" action:nil keyEquivalent:@""];
+ [menuItem setSubmenu:appleMenu];
+ [[NSApp mainMenu] addItem:menuItem];
+
+ /* Tell the application object that this is now the application menu */
+ [NSApp setAppleMenu:appleMenu];
+
+ /* Finally give up our references to the objects */
+ [appleMenu release];
+ [menuItem release];
+}
+
+/* Create a window menu */
+static void setupWindowMenu(void)
+{
+ NSMenu *windowMenu;
+ NSMenuItem *windowMenuItem;
+ NSMenuItem *menuItem;
+
+ windowMenu = [[NSMenu alloc] initWithTitle:@"Window"];
+
+ /* "Minimize" item */
+ menuItem = [[NSMenuItem alloc] initWithTitle:@"Minimize" action:@selector(performMiniaturize:) keyEquivalent:@"m"];
+ [windowMenu addItem:menuItem];
+ [menuItem release];
+
+ /* Put menu into the menubar */
+ windowMenuItem = [[NSMenuItem alloc] initWithTitle:@"Window" action:nil keyEquivalent:@""];
+ [windowMenuItem setSubmenu:windowMenu];
+ [[NSApp mainMenu] addItem:windowMenuItem];
+
+ /* Tell the application object that this is now the window menu */
+ [NSApp setWindowsMenu:windowMenu];
+
+ /* Finally give up our references to the objects */
+ [windowMenu release];
+ [windowMenuItem release];
+}
+
+/* Replacement for NSApplicationMain */
+static void CustomApplicationMain (int argc, char **argv)
+{
+ NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init];
+ SDLMain *sdlMain;
+
+ /* Ensure the application object is initialised */
+ [SDLApplication sharedApplication];
+
+#ifdef SDL_USE_CPS
+ {
+ CPSProcessSerNum PSN;
+ /* Tell the dock about us */
+ if (!CPSGetCurrentProcess(&PSN))
+ if (!CPSEnableForegroundOperation(&PSN,0x03,0x3C,0x2C,0x1103))
+ if (!CPSSetFrontProcess(&PSN))
+ [SDLApplication sharedApplication];
+ }
+#endif /* SDL_USE_CPS */
+
+ /* Set up the menubar */
+ [NSApp setMainMenu:[[NSMenu alloc] init]];
+ setApplicationMenu();
+ setupWindowMenu();
+
+ /* Create SDLMain and make it the app delegate */
+ sdlMain = [[SDLMain alloc] init];
+ [NSApp setDelegate:sdlMain];
+
+ /* Start the main event loop */
+ [NSApp run];
+
+ [sdlMain release];
+ [pool release];
+}
+
+#endif
+
+
+/*
+ * Catch document open requests...this lets us notice files when the app
+ * was launched by double-clicking a document, or when a document was
+ * dragged/dropped on the app's icon. You need to have a
+ * CFBundleDocumentsType section in your Info.plist to get this message,
+ * apparently.
+ *
+ * Files are added to gArgv, so to the app, they'll look like command line
+ * arguments. Previously, apps launched from the finder had nothing but
+ * an argv[0].
+ *
+ * This message may be received multiple times to open several docs on launch.
+ *
+ * This message is ignored once the app's mainline has been called.
+ */
+- (BOOL)application:(NSApplication *)theApplication openFile:(NSString *)filename
+{
+ const char *temparg;
+ size_t arglen;
+ char *arg;
+ char **newargv;
+
+ if (!gFinderLaunch) /* MacOS is passing command line args. */
+ return FALSE;
+
+ if (gCalledAppMainline) /* app has started, ignore this document. */
+ return FALSE;
+
+ temparg = [filename UTF8String];
+ arglen = SDL_strlen(temparg) + 1;
+ arg = (char *) SDL_malloc(arglen);
+ if (arg == NULL)
+ return FALSE;
+
+ newargv = (char **) realloc(gArgv, sizeof (char *) * (gArgc + 2));
+ if (newargv == NULL)
+ {
+ SDL_free(arg);
+ return FALSE;
+ }
+ gArgv = newargv;
+
+ SDL_strlcpy(arg, temparg, arglen);
+ gArgv[gArgc++] = arg;
+ gArgv[gArgc] = NULL;
+ return TRUE;
+}
+
+
+/* Called when the internal event loop has just started running */
+- (void) applicationDidFinishLaunching: (NSNotification *) note
+{
+ int status;
+
+ /* Set the working directory to the .app's parent directory */
+ [self setupWorkingDirectory:gFinderLaunch];
+
+#if SDL_USE_NIB_FILE
+ /* Set the main menu to contain the real app name instead of "SDL App" */
+ [self fixMenu:[NSApp mainMenu] withAppName:getApplicationName()];
+#endif
+
+ /* Hand off to main application code */
+ gCalledAppMainline = TRUE;
+ status = SDL_main (gArgc, gArgv);
+
+ /* We're done, thank you for playing */
+ exit(status);
+}
+@end
+
+
+@implementation NSString (ReplaceSubString)
+
+- (NSString *)stringByReplacingRange:(NSRange)aRange with:(NSString *)aString
+{
+ unsigned int bufferSize;
+ unsigned int selfLen = [self length];
+ unsigned int aStringLen = [aString length];
+ unichar *buffer;
+ NSRange localRange;
+ NSString *result;
+
+ bufferSize = selfLen + aStringLen - aRange.length;
+ buffer = NSAllocateMemoryPages(bufferSize*sizeof(unichar));
+
+ /* Get first part into buffer */
+ localRange.location = 0;
+ localRange.length = aRange.location;
+ [self getCharacters:buffer range:localRange];
+
+ /* Get middle part into buffer */
+ localRange.location = 0;
+ localRange.length = aStringLen;
+ [aString getCharacters:(buffer+aRange.location) range:localRange];
+
+ /* Get last part into buffer */
+ localRange.location = aRange.location + aRange.length;
+ localRange.length = selfLen - localRange.location;
+ [self getCharacters:(buffer+aRange.location+aStringLen) range:localRange];
+
+ /* Build output string */
+ result = [NSString stringWithCharacters:buffer length:bufferSize];
+
+ NSDeallocateMemoryPages(buffer, bufferSize);
+
+ return result;
+}
+
+@end
+
+
+
+#ifdef main
+# undef main
+#endif
+
+
+/* Main entry point to executable - should *not* be SDL_main! */
+int main (int argc, char **argv)
+{
+ /* Copy the arguments into a global variable */
+ /* This is passed if we are launched by double-clicking */
+ if ( argc >= 2 && strncmp (argv[1], "-psn", 4) == 0 ) {
+ gArgv = (char **) SDL_malloc(sizeof (char *) * 2);
+ gArgv[0] = argv[0];
+ gArgv[1] = NULL;
+ gArgc = 1;
+ gFinderLaunch = YES;
+ } else {
+ int i;
+ gArgc = argc;
+ gArgv = (char **) SDL_malloc(sizeof (char *) * (argc+1));
+ for (i = 0; i <= argc; i++)
+ gArgv[i] = argv[i];
+ gFinderLaunch = NO;
+ }
+
+#if SDL_USE_NIB_FILE
+ [SDLApplication poseAsClass:[NSApplication class]];
+ NSApplicationMain (argc, argv);
+#else
+ CustomApplicationMain (argc, argv);
+#endif
+ return 0;
+}
+
diff --git a/dep/recastnavigation/RecastDemo/Source/Sample.cpp b/dep/recastnavigation/RecastDemo/Source/Sample.cpp
new file mode 100644
index 000000000..c437bffa0
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/Sample.cpp
@@ -0,0 +1,201 @@
+//
+// Copyright (c) 2009-2010 Mikko Mononen memon@inside.org
+//
+// This software is provided 'as-is', without any express or implied
+// warranty. In no event will the authors be held liable for any damages
+// arising from the use of this software.
+// Permission is granted to anyone to use this software for any purpose,
+// including commercial applications, and to alter it and redistribute it
+// freely, subject to the following restrictions:
+// 1. The origin of this software must not be misrepresented; you must not
+// claim that you wrote the original software. If you use this software
+// in a product, an acknowledgment in the product documentation would be
+// appreciated but is not required.
+// 2. Altered source versions must be plainly marked as such, and must not be
+// misrepresented as being the original software.
+// 3. This notice may not be removed or altered from any source distribution.
+//
+
+#define _USE_MATH_DEFINES
+#include
+#include
+#include "Sample.h"
+#include "InputGeom.h"
+#include "Recast.h"
+#include "RecastDebugDraw.h"
+#include "DetourDebugDraw.h"
+#include "DetourNavMesh.h"
+#include "DetourNavMeshQuery.h"
+#include "imgui.h"
+#include "SDL.h"
+#include "SDL_opengl.h"
+
+#ifdef WIN32
+# define snprintf _snprintf
+#endif
+
+Sample::Sample() :
+ m_geom(0),
+ m_navMesh(0),
+ m_navQuery(0),
+ m_navMeshDrawFlags(DU_DRAWNAVMESH_OFFMESHCONS|DU_DRAWNAVMESH_CLOSEDLIST),
+ m_tool(0),
+ m_ctx(0)
+{
+ resetCommonSettings();
+ m_navQuery = dtAllocNavMeshQuery();
+}
+
+Sample::~Sample()
+{
+ dtFreeNavMeshQuery(m_navQuery);
+ dtFreeNavMesh(m_navMesh);
+ delete m_tool;
+}
+
+void Sample::setTool(SampleTool* tool)
+{
+ delete m_tool;
+ m_tool = tool;
+ if (tool)
+ m_tool->init(this);
+}
+
+void Sample::handleSettings()
+{
+}
+
+void Sample::handleTools()
+{
+}
+
+void Sample::handleDebugMode()
+{
+}
+
+void Sample::handleRender()
+{
+ if (!m_geom)
+ return;
+
+ DebugDrawGL dd;
+
+ // Draw mesh
+ duDebugDrawTriMesh(&dd, m_geom->getMesh()->getVerts(), m_geom->getMesh()->getVertCount(),
+ m_geom->getMesh()->getTris(), m_geom->getMesh()->getNormals(), m_geom->getMesh()->getTriCount(), 0);
+ // Draw bounds
+ const float* bmin = m_geom->getMeshBoundsMin();
+ const float* bmax = m_geom->getMeshBoundsMax();
+ duDebugDrawBoxWire(&dd, bmin[0],bmin[1],bmin[2], bmax[0],bmax[1],bmax[2], duRGBA(255,255,255,128), 1.0f);
+}
+
+void Sample::handleRenderOverlay(double* /*proj*/, double* /*model*/, int* /*view*/)
+{
+}
+
+void Sample::handleMeshChanged(InputGeom* geom)
+{
+ m_geom = geom;
+}
+
+const float* Sample::getBoundsMin()
+{
+ if (!m_geom) return 0;
+ return m_geom->getMeshBoundsMin();
+}
+
+const float* Sample::getBoundsMax()
+{
+ if (!m_geom) return 0;
+ return m_geom->getMeshBoundsMax();
+}
+
+void Sample::resetCommonSettings()
+{
+ m_cellSize = 0.3f;
+ m_cellHeight = 0.2f;
+ m_agentHeight = 2.0f;
+ m_agentRadius = 0.6f;
+ m_agentMaxClimb = 0.9f;
+ m_agentMaxSlope = 45.0f;
+ m_regionMinSize = 8;
+ m_regionMergeSize = 20;
+ m_edgeMaxLen = 12.0f;
+ m_edgeMaxError = 1.3f;
+ m_vertsPerPoly = 6.0f;
+ m_detailSampleDist = 6.0f;
+ m_detailSampleMaxError = 1.0f;
+}
+
+void Sample::handleCommonSettings()
+{
+ imguiLabel("Rasterization");
+ imguiSlider("Cell Size", &m_cellSize, 0.1f, 1.0f, 0.01f);
+ imguiSlider("Cell Height", &m_cellHeight, 0.1f, 1.0f, 0.01f);
+
+ if (m_geom)
+ {
+ const float* bmin = m_geom->getMeshBoundsMin();
+ const float* bmax = m_geom->getMeshBoundsMax();
+ int gw = 0, gh = 0;
+ rcCalcGridSize(bmin, bmax, m_cellSize, &gw, &gh);
+ char text[64];
+ snprintf(text, 64, "Voxels %d x %d", gw, gh);
+ imguiValue(text);
+ }
+
+ imguiSeparator();
+ imguiLabel("Agent");
+ imguiSlider("Height", &m_agentHeight, 0.1f, 5.0f, 0.1f);
+ imguiSlider("Radius", &m_agentRadius, 0.0f, 5.0f, 0.1f);
+ imguiSlider("Max Climb", &m_agentMaxClimb, 0.1f, 5.0f, 0.1f);
+ imguiSlider("Max Slope", &m_agentMaxSlope, 0.0f, 90.0f, 1.0f);
+
+ imguiSeparator();
+ imguiLabel("Region");
+ imguiSlider("Min Region Size", &m_regionMinSize, 0.0f, 150.0f, 1.0f);
+ imguiSlider("Merged Region Size", &m_regionMergeSize, 0.0f, 150.0f, 1.0f);
+
+ imguiSeparator();
+ imguiLabel("Polygonization");
+ imguiSlider("Max Edge Length", &m_edgeMaxLen, 0.0f, 50.0f, 1.0f);
+ imguiSlider("Max Edge Error", &m_edgeMaxError, 0.1f, 4.0f, 0.1f);
+ imguiSlider("Verts Per Poly", &m_vertsPerPoly, 3.0f, 12.0f, 1.0f);
+
+ imguiSeparator();
+ imguiLabel("Detail Mesh");
+ imguiSlider("Sample Distance", &m_detailSampleDist, 0.0f, 32.0f, 1.0f);
+ imguiSlider("Max Sample Error", &m_detailSampleMaxError, 0.0f, 16.0f, 1.0f);
+
+ imguiSeparator();
+}
+
+void Sample::handleClick(const float* s, const float* p, bool shift)
+{
+ if (m_tool)
+ m_tool->handleClick(s, p, shift);
+}
+
+void Sample::handleToggle()
+{
+ if (m_tool)
+ m_tool->handleToggle();
+}
+
+void Sample::handleStep()
+{
+ if (m_tool)
+ m_tool->handleStep();
+}
+
+bool Sample::handleBuild()
+{
+ return true;
+}
+
+void Sample::handleUpdate(const float dt)
+{
+ if (m_tool)
+ m_tool->handleUpdate(dt);
+}
+
diff --git a/dep/recastnavigation/RecastDemo/Source/SampleInterfaces.cpp b/dep/recastnavigation/RecastDemo/Source/SampleInterfaces.cpp
new file mode 100644
index 000000000..d3d96d6b0
--- /dev/null
+++ b/dep/recastnavigation/RecastDemo/Source/SampleInterfaces.cpp
@@ -0,0 +1,242 @@
+#define _USE_MATH_DEFINES
+#include
+#include
+#include ![[separator]](docs/images/rainbow.gif)
+